KEGG   Pasteurella multocida 36950: Pmu_07770Help
Entry
Pmu_07770         CDS       T01729                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pmp  Pasteurella multocida 36950
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pmp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pmu_07770
Enzymes [BR:pmp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Pmu_07770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
817947..818768
Genome map
AA seq 273 aa AA seqDB search
MYHAIQPIILQQICPELRLVKYNAIPAISLQHDIGSAVIALQGAQLLSWQPKGSAHDVLW
LSEIEPFQLGKAIRGGIPLCYPWFGPVKTPSHGTARIRLWHLIDYAISTDKVRLVFGLFT
EDHLIEAKVSMDFAQDSQVRLTHYGQEDAQVALHSYFHIGDIEQIEIQGLPTDCVSNLTK
QHENVPSPRQIQQNVDCTYHITNAKTSIVDPVLQREISLEHQQASEVVLWNPWHKETSGM
SEFGYQTMVCVETARITQQLKQGEEIAVRITLK
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgtatcacgctattcaaccgataattttgcaacagatttgtcctgaactccgtttagtg
aaatacaatgcaattccagccattagcttgcaacatgacattggtagcgcggtgattgcc
ttacaaggtgctcagcttctcagttggcaaccgaaaggcagtgcacacgatgtgctatgg
ctaagcgaaattgaacctttccaattaggcaaggccattcgtggcgggattccactttgc
tacccatggtttggaccagtgaaaacaccttctcatggcaccgcacgtatccgtttatgg
cacttaatcgactatgctatttcaactgataaagtgcggttagtttttggtttatttact
gaagatcatctcattgaagccaaagtcagcatggattttgctcaagatagccaagtaagg
ttgacccattatgggcaagaagacgcgcaagtggcattacacagctattttcacatcggc
gatattgaacaaatagaaatacaaggcttaccgactgactgtgtcagtaatctgacgaaa
cagcatgaaaatgtgccttctccccgccaaattcagcaaaatgtggactgtacctatcac
atcacaaatgcgaaaacgagcatcgttgaccccgttttacaacgcgagatttctcttgaa
catcaacaggctagcgaagtcgtgctatggaatccatggcacaaagaaaccagtggcatg
agtgagttcggctatcaaactatggtatgcgtagaaacagcacgtattacacagcaactc
aaacagggcgaagaaatagccgttcgtatcacgttaaaatag

DBGET integrated database retrieval system