KEGG   Pasteurella multocida 36950: Pmu_09070Help
Entry
Pmu_09070         CDS       T01729                                 

Gene name
holC
Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
pmp  Pasteurella multocida 36950
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:pmp00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Pmu_09070 (holC)
   00240 Pyrimidine metabolism
    Pmu_09070 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Pmu_09070 (holC)
   03430 Mismatch repair
    Pmu_09070 (holC)
   03440 Homologous recombination
    Pmu_09070 (holC)
Enzymes [BR:pmp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Pmu_09070 (holC)
DNA replication proteins [BR:pmp03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Pmu_09070 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(970771..971199)
Genome map
AA seq 142 aa AA seqDB search
MSKHAQFYLLSEQAQMEKMACDFAASAWRLGKRVLIACETEQQALDIDEALWAREADEFV
PHNLSGEVTTYATPIEVSWKGKRNAQRRDLLINLQAEVPDYVSSFTQVIDFVPVEEHLKV
LARERYKQLRQLGWQLSTEQIK
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaacacgcgcaattttatttgttaagcgagcaagcacaaatggaaaaaatggct
tgtgattttgccgcatccgcgtggcgtcttggtaagcgcgtgttaattgcttgcgaaact
gaacaacaagcgttggatattgatgaagccttatgggcaagagaggcagatgagtttgtg
ccacataatttatcaggtgaagtgacgacgtatgctacaccgattgaggtgagctggaaa
ggtaagcgtaatgcgcaacgccgagatctcttgattaatttacaggcagaggtaccagat
tatgtcagcagttttacacaggtgattgattttgtgccagtggaagagcatttaaaagtg
ctagccagagagcgttataaacaattacgacaacttggctggcaattatcaacagagcaa
atcaagtaa

DBGET integrated database retrieval system