KEGG   Pasteurella multocida 36950: Pmu_09510Help
Entry
Pmu_09510         CDS       T01729                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pmp  Pasteurella multocida 36950
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pmp00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1017014..1017511
Genome map
AA seq 165 aa AA seqDB search
MKSVYIALGSNLQTPIAQLEAALAALANLPTTQLIHVSSFYQSKPLGPQDQPDYVNAVAH
LRTTLPPLTLLDHLQQIENTQGRVRLRRWGERTLDLDILLYDHVVCQTERLTLPHYDMTN
REFVIVPLFEIAPDLCLPSGQSLLELMKKFEDHQMQKIRTASSLD
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctgtctatattgcattaggaagcaatttacaaacaccaattgcgcagttagag
gcggctctggcagcattagctaacttacctacaactcagctaatccatgtcagttctttt
taccaaagtaagccacttggtccacaagatcagccagattacgtaaatgcggtagcgcat
ttacgaactacgctaccgcccttaacgctccttgatcatttacagcagattgaaaataca
caaggtagagtgcgccttcgccgttggggtgaacgcactttagatctagatattttgctt
tacgatcatgtcgtatgtcagactgaacgcttgacccttccccattacgatatgaccaat
cgtgaatttgtgatcgtccccctgttcgaaattgcccctgatttatgtttaccgagtgga
caatctctgctggaattaatgaaaaaattcgaagatcaccaaatgcagaaaatacgtaca
gcgtctagtcttgattag

DBGET integrated database retrieval system