KEGG   Pasteurella multocida 36950: Pmu_09820Help
Entry
Pmu_09820         CDS       T01729                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pmp  Pasteurella multocida 36950
Pathway
pmp00010  Glycolysis / Gluconeogenesis
pmp00020  Citrate cycle (TCA cycle)
pmp00620  Pyruvate metabolism
pmp01100  Metabolic pathways
pmp01110  Biosynthesis of secondary metabolites
pmp01120  Microbial metabolism in diverse environments
pmp01130  Biosynthesis of antibiotics
pmp01200  Carbon metabolism
Module
pmp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pmp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pmu_09820 (aceF)
   00020 Citrate cycle (TCA cycle)
    Pmu_09820 (aceF)
   00620 Pyruvate metabolism
    Pmu_09820 (aceF)
Enzymes [BR:pmp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Pmu_09820 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H NQRA Ribosomal_60s
Motif
Other DBs
NCBI-ProteinID: AET15881
Position
complement(1048094..1049992)
Genome map
AA seq 632 aa AA seqDB search
MSKQIQVPDIGGDEVTVTEVMVKAGDTVAVDQSVINVEGDKASMEVPSPEAGVIKEVLVK
VGDKVSTGSPMFVLETGDAKPAETPKAETAPVSAPAPAASAVVEVHVPDIGGDEVNVTEI
MVKVGDKVEVEQSIINVEGDKASMEVPAPIAGVVKEILINVGDKVSTGSLIMKFETGDAP
AVATPAQAPTAAPSAPAQSAVKDVNVPDIGGDEVNVTEIMVNVGDTITEEQSLITVEGDK
ASMEVPAPFAGVVKEILVKSGDKVSTGSLIMRFEVAGAAPSAAPAQPAPAAQAAAPQAAT
PAPVASAPAGDAEVTGSSVFAYATPVVRRLAREFGVNLDKVKGTGRKGRILKEDVQAYVK
AAIKAVESGSVSAAPAGSGVANGAGLGLLPWPKVDFSKFGEVEEVELTRINKISGANLHR
NWVMIPHVTHFDRADITDLEAFRKEQNVLAEKQKWGVKITPVVFIMKAAAKALEAYPRFN
SSISEDGQRLTLKKYVNIGVAVDTPNGLVVPVFKDVNKKGIIELSRELMEVSKKARDGKL
TASDMQGGCFTISSLGGLGTTHFAPIVNAPEVAILGVSKSEMAPVWNGKEFTPRLMLPLS
LSFDHRVIDGADGARFISYINGVLSDLRRLVM
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaacaaattcaagtaccagatattggtggtgatgaagtgactgtgacagaagtc
atggtaaaagcgggtgatacggttgcagttgatcaaagcgtaatcaatgtagaaggtgat
aaagcctcaatggaagtcccttcaccagaagcgggtgtgatcaaagaagtgttagtgaaa
gtgggtgacaaagtgtcaacgggttcaccgatgtttgtgttagaaacgggtgatgcaaaa
cctgctgaaacgccaaaagctgaaacagcaccagtatctgcgccagcgccagcagcaagc
gcagtggttgaagtacatgtccccgatattggtggtgatgaagttaacgtgacagaaatc
atggtcaaagtgggtgataaagttgaggttgagcaatcgatcatcaatgtagaaggtgat
aaagcctcaatggaagtcccagccccaatcgcaggtgttgttaaagaaattctaatcaat
gttggtgacaaagtatcaacaggatcattgattatgaaatttgaaacgggtgatgcgcca
gcagtagcgacaccagcacaagcgccaacagctgcgccatcagcacctgcacaaagtgcg
gtaaaagatgtgaacgtgccagatattggtggtgacgaagtcaacgtgacggaaatcatg
gtgaacgtgggtgacacgatcacagaagaacaatcattaattactgttgaaggtgataaa
gcttcaatggaagtgcctgcgccatttgccggtgtggtaaaagaaattttagtgaaatct
ggcgacaaagtctctacgggttcattaattatgcgctttgaagtagcgggagccgcacct
tcagcagcaccagcacaacctgcacctgctgcacaagcggcagcaccacaagcagcaacg
ccagcaccggttgcaagcgcgccagcgggtgatgcagaagtaacaggtagttctgtattt
gcttatgccacaccggttgtacgtcgtttagcacgtgaatttggtgtgaacctcgataaa
gtgaaaggtactggtcgtaaaggtcgtatcttaaaagaagacgttcaagcatatgtgaaa
gcagcaatcaaagcggttgaatcaggttctgtatctgcagcgccagcgggcagcggtgta
gcaaatggtgcaggcttaggcttattgccatggccgaaagtggatttcagcaagtttggt
gaagtggaagaagtagaactcacccgtattaacaaaatttcgggtgcaaacttacaccgt
aactgggtgatgatcccgcatgttacacatttcgatcgtgccgatattactgacttagaa
gcgttccgtaaagaacaaaatgtgttagcggaaaaacaaaaatggggtgtgaaaatcacg
ccagtggtgtttatcatgaaagcggctgccaaagcattagaagcgtatccacgttttaat
agctcgatttctgaagatggtcaacgtttaaccttgaaaaaatatgtcaatattggtgtg
gcagtggatacaccaaacggcttagtcgtgcctgtctttaaagatgtcaacaaaaaaggc
attatcgaactttctcgtgaattaatggaagtgtcgaaaaaagcacgtgacggcaaatta
accgcttcggatatgcaagggggttgtttcacgatttcaagcttagggggcttaggtacg
acacactttgcgccaatcgtgaatgcgccagaagtcgcaattctaggtgtgtctaaatca
gaaatggcgccagtttggaacggtaaagaatttacgccacgcttaatgttgccattatca
ttgtctttcgaccaccgtgtgatcgatggtgcagatggcgcacgtttcattagctatatc
aatggcgtgttatctgatcttcgtcgtttagttatgtaa

DBGET integrated database retrieval system