KEGG   Pasteurella multocida 36950: Pmu_10280Help
Entry
Pmu_10280         CDS       T01729                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pmp  Pasteurella multocida 36950
Pathway
pmp00020  Citrate cycle (TCA cycle)
pmp00310  Lysine degradation
pmp01100  Metabolic pathways
pmp01110  Biosynthesis of secondary metabolites
pmp01120  Microbial metabolism in diverse environments
pmp01130  Biosynthesis of antibiotics
pmp01200  Carbon metabolism
Module
pmp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pmp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pmp00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pmu_10280 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    Pmu_10280 (sucB)
Enzymes [BR:pmp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Pmu_10280 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: AET15921
Position
complement(1100662..1101876)
Genome map
AA seq 404 aa AA seqDB search
MSNFEIITPDLPESVADATVVTWHKKVGDVVKRDEILVEIETDKVVLEVPAQSDGVLEAI
IEAEGATVISKQLLGKLSATAVAGGVTKETVVTQEPTPADRHHANLSTESVGSDSVSPGV
RRLIAEHDLNAENIKGSGVGGRITREDVEKVIAQKANKAPNKPAEPAFVVGNREEKRVPM
TRLRKRIAERLLEAKNSTAMLTTFNEVDMAPIMKLRKTYGEKFEKQHGTRLGFMSFYIKA
VVEALKRYPEVNASIDGDDIIYHNYFDISIAVSTPRGLVTPVLRNCDKLSMADIEKEIKA
LADKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPVAVNGE
VVIRPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLLEI
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgagcaattttgagattataactcccgatttaccagaatctgtcgccgatgcaacggtt
gtaacttggcataagaaagtgggtgatgtcgtaaaacgtgatgagattttagtcgaaatt
gaaaccgataaagtggtacttgaagtcccagcacaatctgatggtgtacttgaagcgatt
attgaagcagaaggcgccaccgttatcagtaaacaattattaggtaaattgtcagccaca
gccgtagcgggtggtgtcactaaagaaacggttgtcactcaggagccaacgccggcggat
cgccatcatgcgaatttaagtactgaatcagtgggtagcgactcggtgagcccgggggta
cgtcgtttaattgctgagcatgacttaaatgcagaaaacattaaaggaagcggtgtgggc
gggcgtattacacgcgaagatgtggagaaagttatcgcgcaaaaagccaataaagcgccg
aataagccggctgagcctgcgtttgttgtcggtaatcgtgaggaaaaacgtgtaccaatg
acacgtttacgcaaacgtattgcggagcgtttgttagaagcgaaaaacagcacggcaatg
ttaaccacatttaacgaagtggacatggcgccgattatgaaattacgtaaaacttatggt
gagaagtttgaaaaacaacacggcacgcgtctcggttttatgtcgttctacattaaagct
gtggtggaagcactaaaacgttatccagaagtcaatgcgtcgattgatggtgacgatatc
atttatcataactatttcgatatcagcatcgcggtttcgacaccacgtggtttagttacc
ccagtattacgcaactgcgataaattaagcatggcggatattgaaaaagaaattaaagcg
cttgctgataaggggcgtgacggaaaattaacagttgaagatttaaccgggggtaacttt
actattactaatggtggtgtgttcggttccctcatgtctaccccgattatcaatcctcca
caaagtgccattttaggcatgcatgccattaaagatcgccccgtggcggtgaatggcgaa
gtggtgattcgtccgatgatgtatcttgcgctctcctatgatcaccgtttaattgatggt
cgtgaatcagttggtttcttagtaacgattaaagaattgttggaagatccaacccgttta
ttgttagaaatctaa

DBGET integrated database retrieval system