KEGG   Pasteurella multocida 36950: Pmu_10610Help
Entry
Pmu_10610         CDS       T01729                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pmp  Pasteurella multocida 36950
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:pmp00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1141951..1142838
Genome map
AA seq 295 aa AA seqDB search
MQHYHFSHSLLAQQEKPYRFPCPAKLNLFLYINGKRQDGYHELQTLFQFVDFGDWLDIEV
REDNEICLTPELPSLKNEDNLVYRAAKLLQQKTNCALGANLTLDKILPMGSGLGGGSSNA
ATALVALNYLWNTQLSTKQLAKLGLMLGADVPIFVHGHAAFAEGVGEKITYCEPKEKWYV
VLKPNVSISTATVFSDPDLIRNTPKQSLEQLLNQKYTNDCEKVVLNHYPEVEEILHRLLQ
YAPSRLTGTGACVFAEFNDEESAQLAFQTIPKNYFGFVAQGLNKSPLHNMLAKIS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgcaacattatcatttttctcactcacttttagcacaacaagaaaaaccatatcgtttc
ccttgtccggctaaacttaacttatttctctacattaatgggaaacgtcaagatggttat
cacgaactacaaaccctttttcaatttgttgattttggtgattggttagatattgaggtt
cgcgaagataacgaaatctgcctaacgccagaactcccctcactaaaaaatgaagataat
ttagtctatcgcgcagcaaaattactgcaacaaaaaaccaattgtgctttaggcgccaat
ctgacacttgataagattctaccgatgggaagtgggctcgggggaggctcgtctaatgcg
gcaacagcattagtcgcattaaattacctgtggaatacgcaactcagcacaaaacaactt
gctaaactaggattaatgctcggtgcagacgtaccaatttttgtccatggtcacgcggca
tttgctgaaggagtaggtgaaaaaattacttattgtgagccaaaagagaaatggtatgtg
gttttaaagccaaatgtgtctatatcaaccgcgaccgtcttttctgatccagatttaatt
cgtaatacccctaagcaatctctggagcaactcctcaatcaaaaatatacaaacgattgt
gaaaaagttgtgttaaatcattatccagaggttgaagaaatactccacagattgttacaa
tatgcgccatcaagattaacaggcaccggcgcttgtgtatttgccgaatttaatgacgaa
gaaagtgcacaactcgcatttcaaacaatacccaaaaactattttggttttgtcgcacaa
ggattaaataaatcacctttacataatatgctagcgaaaatcagctag

DBGET integrated database retrieval system