KEGG   Pasteurella multocida 36950: Pmu_10610Help
Entry
Pmu_10610         CDS       T01729                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pmp  Pasteurella multocida 36950
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmp00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Pmu_10610 (ispE)
Enzymes [BR:pmp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Pmu_10610 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1141951..1142838
Genome map
AA seq 295 aa AA seqDB search
MQHYHFSHSLLAQQEKPYRFPCPAKLNLFLYINGKRQDGYHELQTLFQFVDFGDWLDIEV
REDNEICLTPELPSLKNEDNLVYRAAKLLQQKTNCALGANLTLDKILPMGSGLGGGSSNA
ATALVALNYLWNTQLSTKQLAKLGLMLGADVPIFVHGHAAFAEGVGEKITYCEPKEKWYV
VLKPNVSISTATVFSDPDLIRNTPKQSLEQLLNQKYTNDCEKVVLNHYPEVEEILHRLLQ
YAPSRLTGTGACVFAEFNDEESAQLAFQTIPKNYFGFVAQGLNKSPLHNMLAKIS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgcaacattatcatttttctcactcacttttagcacaacaagaaaaaccatatcgtttc
ccttgtccggctaaacttaacttatttctctacattaatgggaaacgtcaagatggttat
cacgaactacaaaccctttttcaatttgttgattttggtgattggttagatattgaggtt
cgcgaagataacgaaatctgcctaacgccagaactcccctcactaaaaaatgaagataat
ttagtctatcgcgcagcaaaattactgcaacaaaaaaccaattgtgctttaggcgccaat
ctgacacttgataagattctaccgatgggaagtgggctcgggggaggctcgtctaatgcg
gcaacagcattagtcgcattaaattacctgtggaatacgcaactcagcacaaaacaactt
gctaaactaggattaatgctcggtgcagacgtaccaatttttgtccatggtcacgcggca
tttgctgaaggagtaggtgaaaaaattacttattgtgagccaaaagagaaatggtatgtg
gttttaaagccaaatgtgtctatatcaaccgcgaccgtcttttctgatccagatttaatt
cgtaatacccctaagcaatctctggagcaactcctcaatcaaaaatatacaaacgattgt
gaaaaagttgtgttaaatcattatccagaggttgaagaaatactccacagattgttacaa
tatgcgccatcaagattaacaggcaccggcgcttgtgtatttgccgaatttaatgacgaa
gaaagtgcacaactcgcatttcaaacaatacccaaaaactattttggttttgtcgcacaa
ggattaaataaatcacctttacataatatgctagcgaaaatcagctag

DBGET integrated database retrieval system