KEGG   Pasteurella multocida 36950: Pmu_11060Help
Entry
Pmu_11060         CDS       T01729                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
pmp  Pasteurella multocida 36950
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pmp03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1188814..1189416)
Genome map
AA seq 200 aa AA seqDB search
MQTSPLLEHLIESLRCLPGVGPKSAQRMAYHLLQRNRNGGMELARALTEAMSKIGHCSHC
RTFTEEEVCTICNNPRRQHSGLLCVVEQPSDIQAIEQTGQFSGRYFVLMGHLSPLDGIGP
KEIGLHLLQKRLQEESFHEVILATNPTVEGDATANYIAELCMQQNIKVTRIAHGIPVGGE
LEMVDGTTLTHSFLGRRQLG
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccagcccattactcgaacatttgatcgaaagtttacgttgtttacccggtgtt
ggaccaaaatctgctcaacgtatggcatatcacttattacaacgtaatcgtaatggaggc
atggaacttgcccgcgctttaacggaagcgatgtcaaaaatcggacattgcagccattgt
cgtacttttacggaagaagaggtgtgcacgatttgtaacaaccctcgccgtcagcattca
ggtctactttgtgtggttgagcagccgtctgatattcaagccattgaacaaacaggacag
ttttcagggcgttattttgtgttaatggggcatttatcaccattagatggaattggtcct
aaagaaattggtttgcatttattacaaaaacgcttgcaagaagaaagctttcatgaagtg
attttggctactaacccaaccgtcgaaggtgatgccacagcgaattacatcgcagagctt
tgtatgcaacaaaatatcaaagtcacccgtattgcgcatgggattccagtggggggggaa
ttagaaatggtggatggtacaaccttgactcattcctttttaggacgtcgccaactcggg
taa

DBGET integrated database retrieval system