KEGG   Pasteurella multocida 36950: Pmu_11330Help
Entry
Pmu_11330         CDS       T01729                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
pmp  Pasteurella multocida 36950
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Pmu_11330 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Pmu_11330 (murA)
Enzymes [BR:pmp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Pmu_11330 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1217262..1218494)
Genome map
AA seq 410 aa AA seqDB search
MNISGAKNAALPILFAAILAQEPVKLTNVPELKDIETTLKILRKLGVVVERDAEGAVHLD
ASKIDHFVAPYELVKTMRASIWALAPLVARFHRGQVSLPGGCSIGARPVDLHISGLERLG
ASIILEDGYVKAYVDHCLVGTRIVMEKVSVGATLSIMMAATLAKGKTIIENAAREPEITD
TALFLNKMGAKIVGAGTDTITVEGVERLGGCEHSIVPDRIETGTFLVAAAISGGRIECKN
TKADTLDAVIDKLREAGAQVDVTENSITLDMLGNRPRAVNIRTAPYPGFPTDMQAQFTLL
NMVACGTSIITETIFENRFMHIPELIRMGGKAEIEGNTAICHGVDHLSGAEVMATDLRAS
ISLVLAGCIATGETIVDRIYHIDRGYERIEEKLRGLGARIERFSAQSEES
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
gtgaatatttcaggggcaaagaatgccgcgttgcctattttatttgcagcgattttagcg
caagagccagttaaattgaccaatgtaccagaattaaaagatattgaaaccaccttaaaa
attctgcgcaaactcggtgtcgttgttgaacgtgatgctgaaggggcggtgcacttagat
gcgtcaaaaattgatcacttcgttgcaccttatgaactggttaaaaccatgcgtgcgtca
atttgggcattagccccgttagtggcgcgttttcatcgtggtcaagtgtctttaccggga
ggctgttctattggtgctcgtccagtggatctacatatcagtggtttagaacgtttaggg
gcaagcatcattttagaagatggctatgtaaaagcctatgttgatcactgtttagtcggt
actcgtattgtgatggaaaaagtgagtgtgggcgcaacgttatctattatgatggcggca
acactggccaaagggaaaaccatcattgagaatgctgcacgtgaaccggaaattacggat
acagcactgtttttgaataaaatgggggctaaaattgtaggggctggtactgatactatt
accgtggaaggcgttgagcgtttaggtggttgtgagcatagcattgtgcctgatcgcatt
gaaacagggactttcttagtggctgccgccatttcaggtggacgcattgaatgtaaaaat
accaaagcagatactttggatgcggtaattgataaattacgtgaggcaggagcccaagtg
gatgtgacagaaaacagcattactttggatatgctgggtaatcgaccacgagctgtcaat
attcgtactgcaccttatcccggttttccaacggatatgcaagcacaatttactttatta
aacatggtggcatgtggtaccagtatcattactgaaaccatttttgaaaatcgctttatg
catatcccagagcttattcgtatggggggcaaagctgaaattgaaggcaatacagcgatt
tgccatggtgttgatcatttaagtggcgctgaagtgatggcaacggatttacgggcttct
atcagtttagttctggctggatgtattgctaccggtgaaaccattgtcgatcgtatttat
cacattgatcgtggctacgagcgaatcgaagaaaaactgcgtggcttaggcgcacgtatc
gaacgtttttcagcacaaagtgaagaaagttaa

DBGET integrated database retrieval system