KEGG   Pasteurella multocida 36950: Pmu_11610Help
Entry
Pmu_11610         CDS       T01729                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pmp  Pasteurella multocida 36950
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pmp00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Pmu_11610 (rbsK)
Enzymes [BR:pmp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Pmu_11610 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1240061..1240981
Genome map
AA seq 306 aa AA seqDB search
MKKLTVLGSVNADHVISVPHFAKPGETLTGNHYHIAYGGKGANQAVAAARLGANIDFIAC
IGDDAIGQAMKKAFQQDGINTQAVVEIADQMTGIAMIQVNAHGENSIVIAAGANAYLTET
VVEQFANKITQADTLLMQLETPLSAVIFAAKLAKSANTKVVLNPAPAQPLPDELLMQLDM
ITPNETETEILTGVKVVDEHSASQAAALFHQKGIETVLITLGSKGVYASQKGTPGKMVAG
FRVDAKDTTAAGDTFNGALMTALLEDKPLADAIRFAHAAAAISVTRAGAQPSIPTRQETL
NFLQSH
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattaacggtacttggcagtgtaaatgccgatcatgtcatttctgtcccacac
tttgctaaacccggtgaaaccctcacaggcaatcattaccatattgcgtatggaggaaaa
ggtgcaaaccaagctgttgcggctgctcgcttaggtgccaatattgattttattgcttgt
attggtgatgatgcgattggacaagcaatgaaaaaggctttccaacaagatggcattaat
acacaagccgttgtagaaattgccgatcaaatgacaggaatcgccatgattcaagtcaac
gcacacggggaaaacagtattgtcattgccgccggagcaaatgcttatttaacggaaact
gtcgttgaacaattcgcgaataaaattacgcaagcggatactttattaatgcaacttgaa
acccctttaagtgcggtcattttcgcggcaaaattggctaaatcagccaatactaaagtg
gtattaaatccggcaccggcccagccacttcccgatgagttactcatgcaattggacatg
attacccctaatgaaacagaaactgaaatcttgactggggtgaaggttgttgacgaacat
tctgcttcgcaagcggcggctctctttcatcaaaaaggcattgaaacggtgctcatcact
ttaggctcaaaaggggtttatgcaagtcagaaaggtacgccgggcaaaatggtcgcaggc
tttcgtgtcgatgcgaaagacacaactgccgcaggtgatacgtttaatggcgctttaatg
actgcattgttggaagataaaccgcttgctgatgccatccgttttgcccatgctgccgca
gcaattagcgtcaccagagcgggcgcacaaccctcaattccgactagacaagaaaccctc
aactttttacaatcacattaa

DBGET integrated database retrieval system