KEGG   Pasteurella multocida 36950: Pmu_11980Help
Entry
Pmu_11980         CDS       T01729                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pmp  Pasteurella multocida 36950
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pmp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pmu_11980 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pmu_11980 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Pmu_11980 (thrC)
Enzymes [BR:pmp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Pmu_11980 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1278506..1279780)
Genome map
AA seq 424 aa AA seqDB search
MNLYNIKHPEEQVNFAQAVRQGLGKNQGLFFPETLPHFEDIDALLALPLVERSQKILSAL
IGEEISPTQLAKMVENAFTFPAPVAKVEEGVYALELFHGPTLAFKDFGGRFMAQALATVR
GEGKITILTATSGDTGAAVAHAFYGLENIDVVILYPQGKISPLQEKLFCTLGGNIRTIAI
NGDFDDCQALVKQAFDDAELRQAIGLNSANSINISRLLAQVCYYFEAVAQLPKAARDNLV
VSVPSGNFGNLTAGLIAKSLGLPIKRFVASTNVNDTVPRYLRSGNWQPHDTVATLSNAMD
VSRPNNWPRVEELFKRNGWALSDLHSDAVNDNETEQTLKAMYAKGYLCEPHGAVAYRVLK
QDLQPGETGLFLCTAHPAKFKESVERILALELPLPDALAKHAALPLLSDIMENDFAKLRA
YLLA
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaatttatacaacattaaacatccagaagaacaagtcaattttgcacaagcggtacgt
caaggattaggcaaaaaccaagggttgttttttccagaaaccctaccgcactttgaggat
atagatgcgctgttagcgttaccattggtggagcgtagccagaagattttatctgcgtta
attggtgaggaaatttcgccaacccagttagcaaaaatggtagaaaatgcctttactttc
ccagcacctgtagcaaaagtggaagaaggtgtttatgcactcgaattatttcatggtcca
accttagccttcaaagattttggtggtcgcttcatggcacaagccttagccacagtacgt
ggtgagggtaaaattacgattttaacggcaacgtcaggggatactggagcggcggttgct
cacgctttttatggtttagaaaacattgatgtggtgattttatatccacaaggcaaaatc
agcccgctacaagaaaagttattctgtacgcttggtggcaatattcgtacgattgcaatc
aacggggattttgatgattgtcaggcattagtgaaacaagcgtttgatgatgcagagttg
cgtcaagcgattggcttaaactcagcaaattcgatcaatatcagccgtttattagcgcag
gtttgttattattttgaggcggttgcgcaattaccaaaagcggcacgcgataatcttgtg
gtatcggtaccaagtggtaactttggtaacctgaccgcaggcttaatcgccaagtcttta
ggcttgccaattaaacgttttgtggcgtcaaccaatgtgaatgataccgtaccgcgttat
ttacgcagtggtaattggcaaccgcatgacacggtggcgacgttatccaatgcaatggat
gtgagtcgtccaaataactggccacgggttgaagagttatttaaacgcaatggttgggcg
ctatcagatttgcattctgatgccgtaaatgacaatgaaacggaacaaaccttaaaagcc
atgtatgccaaagggtacttgtgtgaaccacatggtgcggtggcttatcgtgtgttaaaa
caagatttacagccaggtgaaaccggcttattcctctgtacggcacatcctgcgaaattt
aaagaaagtgttgaacgtattttagcgcttgaattacctttacccgatgcattagcaaaa
cacgcggctttaccgttgctttcggatatcatggaaaatgattttgcgaaattacgtgcg
tatttgttagcttaa

DBGET integrated database retrieval system