KEGG   Pasteurella multocida 36950: Pmu_12490Help
Entry
Pmu_12490         CDS       T01729                                 

Gene name
nagZ
Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pmp  Pasteurella multocida 36950
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Pmu_12490 (nagZ)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Pmu_12490 (nagZ)
Enzymes [BR:pmp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Pmu_12490 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1327837..1328892
Genome map
AA seq 351 aa AA seqDB search
MSTLLIDLQGQELSQEEVELLSHPLVAGLILFTRNFHDRAQMQALIQSIRQRVKKPLLIT
VDQEGGRVQRFREGFTQLPAMQAFACLIDDPVQQTNMAQQAGWQMAAEMTALGIDLSFAP
VLDLGHQCQAIGDRSFHSQAEMTLNLASAFIDGMHQVGMAATGKHFPGHGHVIADSHLET
PYDERPKQQIFAQDIQPFQQLIQQNMLDAIMPAHVIYSQCDPQPASGSAYWLKQVLRQQL
GFNGAIFSDDLGMKGAGFMGDFVQRCEQSLQAGCDLLLLCNEREGVIQVLDNLKLSETEP
HFALRQQRLQQLFKRKTIRWSELEATSRWLENRKILTALQQRWLDNKANKH
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacactattgatcgatttacaaggtcaagaacttagccaagaagaagtcgaactg
ttatcacatcctttagtagcagggctcattttatttacacggaatttccatgatcgcgcc
caaatgcaagcgctgatccaatcgattcgtcaacgcgtcaagaagccgttgttgattacg
gtggatcaagaaggtggacgggttcagcgttttcgtgaaggtttcacccaacttcctgct
atgcaagcctttgcctgtttaatcgatgatcctgtacaacaaacaaacatggcacagcaa
gctgggtggcaaatggcagcagaaatgaccgcacttggtattgatctcagctttgcgcct
gttttagatttaggacatcaatgtcaagccattggcgaccgcagttttcattcacaagca
gaaatgacactcaaccttgccagcgcctttattgacggtatgcatcaagtgggaatggcc
gccacgggtaagcattttccgggtcatggtcatgtgattgcagattcacatttagaaacg
ccttatgatgaacgtccaaaacaacagatctttgcgcaagatattcagccattccagcag
ttgattcaacaaaatatgctcgatgccatcatgcctgcacatgtgatttatagccaatgc
gatcctcaacctgcgagtggttctgcatattggttaaaacaggtactacgccaacaactt
ggctttaacggtgctattttctctgatgatctcggtatgaaaggcgccggctttatgggg
gattttgtgcaacgttgtgagcaatctttgcaggcgggttgtgatttactgttactgtgt
aatgaaagagaaggcgttatccaagtgttagataatttaaaactttctgaaacagagccg
cactttgccctacgtcaacaacgtttacagcagcttttcaaacgtaaaactattcgttgg
tctgaattggaagccacttcacgttggttagaaaatcgcaaaatattgaccgcacttcaa
caacgctggcttgataacaaagccaacaaacattaa

DBGET integrated database retrieval system