KEGG   Pasteurella multocida 36950: Pmu_12510Help
Entry
Pmu_12510         CDS       T01729                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pmp  Pasteurella multocida 36950
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:pmp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pmu_12510 (pfkA)
   01230 Biosynthesis of amino acids
    Pmu_12510 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pmu_12510 (pfkA)
   00030 Pentose phosphate pathway
    Pmu_12510 (pfkA)
   00051 Fructose and mannose metabolism
    Pmu_12510 (pfkA)
   00052 Galactose metabolism
    Pmu_12510 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    Pmu_12510 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Pmu_12510 (pfkA)
Enzymes [BR:pmp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Pmu_12510 (pfkA)
Protein phosphatases and associated proteins [BR:pmp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Pmu_12510 (pfkA)
Messenger RNA biogenesis [BR:pmp03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Pmu_12510 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1330182..1331147)
Genome map
AA seq 321 aa AA seqDB search
MIKKIAVLTSGGDAPGMNAAIRGVVRSALAAGLEVYGIYEGYYGLYHNKVKQMTRYSVSD
IINRGGTFLGSARFPEFKDPAVRAKCAEILRSHGIDALVVIGGDGSYMGAKLLTEEHGFP
CVGIPGTIDNDVAGTDYTIGYQTALQTAVEAIDRLRDTSSSHQRISIVEIMGRHCSDLAI
SAGIAGGCEYIVASEVEFNREELIQQIERSIIKGKRHAIIAITELICDVNELAREIESRV
KHETRATILGHIQRGGTPCAFDRILGSRMGVYAVDLLMQGKGGYCVGIQNEQLVHHDIID
AINNMRREFKADWLALSKRLD
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaaaatagcagtattaaccagtggtggtgacgcaccgggcatgaatgccgcc
attcgcggcgtggttcgttcagcacttgcggcaggattagaagtatacggtatttatgaa
ggctattatgggttatatcataataaagtgaaacaaatgacccgttatagtgtttccgac
attattaaccgcggcggtacttttttaggatcggcgcgttttcctgaatttaaagatcct
gcggttcgcgctaaatgtgctgaaattttacgttcccatggtattgatgcacttgtggtg
attggtggggacggttcttacatgggggcaaaattactgacggaagaacatggtttccct
tgtgtcggtatcccgggtacgattgataacgatgtggcagggacagactacactatcggt
tatcaaaccgcgttacagacagccgtcgaagccattgaccgtttacgcgatacctcaagc
tcgcaccaacgtatttcgattgttgaaatcatgggacgtcattgtagtgatttagctatt
tcagcgggtattgctggtggttgtgagtatattgtggcatcggaagtagaatttaaccgt
gaagagttaattcaacagattgagcgcagtattatcaaaggtaaacgtcatgccattatt
gcaattactgagttaatttgtgatgtgaatgaattagcccgtgaaattgaatcgcgtgtg
aaacatgaaactcgtgctaccattttaggtcatattcaacgtggcggtacgccttgcgca
tttgaccgtattttaggttcacgtatgggcgtttatgcggttgatttattaatgcaaggt
aaaggtggctattgcgttggtattcaaaatgaacaattagttcaccacgatattattgat
gcaatcaacaatatgcgccgtgaatttaaagcggattggttagcattatcaaaacgttta
gactaa

DBGET integrated database retrieval system