KEGG   Pasteurella multocida 36950: Pmu_14380Help
Entry
Pmu_14380         CDS       T01729                                 

Gene name
proB
Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
pmp  Pasteurella multocida 36950
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pmp01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pmp00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1540886..1541989)
Genome map
AA seq 367 aa AA seqDB search
MKIDKTLVVKFGTSTLTQGSAKLNLPHMMDIVRQLAQLHQAGFRLVIVTSGAIAAGRHYL
NHPKLPPTIASKQLLAAVGQSQLIQTWEKLFAIYDIHIGQILLTRADIEDRERFLNARDT
LRALLDNQIIPVINENDAVATSEIKVGDNDNLSALVAILVQAEQLYLLTDQQGLFDRDPR
KHPDAKLIADVDKITDHIRAIAGGSGTSLGTGGMSTKISAADVATRSGIETIIAPGNRPN
VIVDLAYGQAIGTKFSVQADRLESRKQWLYAAPSAGIITIDAGAENAMLMQHKSLLPAGI
VNVEGRFSRGEVVKIRTQQGKDVALGMPRYNSDALHLIQGKHSQDIEQVLGYEYGAVAVH
RDDMIVL
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcgacaaaacactcgttgtgaaatttggaaccagtacgcttacgcaaggatcg
gcgaagttaaatttacctcatatgatggatattgtgcgtcagctcgcacagcttcatcaa
gcgggctttcgtttagtgattgtcacctcaggggcgattgcggcaggtcgtcattattta
aatcacccgaaattgccaccgacgattgcctcgaaacaattattggctgcggtaggacaa
agtcagctcattcaaacgtgggaaaaattgtttgccatttatgatattcatattggacag
attttattgacccgtgccgacattgaagatcgtgaacgttttttaaatgccagagatact
ttgcgcgccttattagataatcagattattccagtgattaatgaaaatgacgctgtcgct
acgtcagaaattaaagtaggcgataacgataatttatccgcgttagtggcgattttagtg
caagcagaacagttgtatttgcttactgatcagcaaggtttgtttgatcgtgatccgcgc
aaacatccagacgccaaattgatcgccgacgtggacaaaattaccgatcatattcgcgcg
attgcgggcggaagtggcacctcgttaggcacaggtggcatgtccaccaaaatcagtgcc
gcggatgtggcaacccgctccggcattgaaaccattattgcaccgggtaatcgcccgaat
gtgattgtggacttagcttatgggcaagccattggcaccaaatttagtgtgcaagcagat
cgcttagaaagtcgtaaacaatggctatatgcggcgccgtcagccggtattattaccatt
gatgcaggggcggaaaacgcgatgttaatgcaacataaatcgttattgcctgctgggatt
gtgaacgtggaaggacgcttttcacgcggtgaagtggtaaaaattcgtactcagcaaggc
aaggatgtcgccttagggatgccacgttataacagcgatgcactccatttaattcaaggc
aaacattcgcaagatattgaacaggttctcggttatgaatatggggcggttgcggtacac
cgcgacgatatgattgtgttataa

DBGET integrated database retrieval system