KEGG   Pasteurella multocida 36950: Pmu_16980Help
Entry
Pmu_16980         CDS       T01729                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pmp  Pasteurella multocida 36950
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmp00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Pmu_16980 (glpK)
Enzymes [BR:pmp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Pmu_16980 (glpK)
Exosome [BR:pmp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Pmu_16980 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1817511..1819019
Genome map
AA seq 502 aa AA seqDB search
MTDKKYIIALDQGTTSSRAVLLDHDANIVEIAQREFTQIYPQAGWVEHNPMEIWATQSST
LNEVVAKAGITADQIAAIGITNQRETTIVWEKETGKPIYNAIVWQCRRTTEITDKLKADG
HEDYIRQTTGLVVDPYFSGTKIKWILDNVEGAREQAERGELLFGTVDTWLVWKLTQGRAH
VTDYTNASRTMLFNIHTLQWDDNMLAILGIPRAMLPEVRNSSEIYGQTNIGGKGGVRIPV
AGMAGDQQAALYGHLCVNAGQAKNTYGTGCFMLMHTGDKAVQSQNGLLTTIACNAKGEPA
YALEGSIFMGGASIQWLRDELKIVHDSYDSEYFATRVPDCNGVYVVPAFTGLGAPYWDPY
ARGAIFGLSRGANRNHIVRATLESIAYQTRDVLEAMQSDSGQTLQALRVDGGATENNFLM
QFQADILATKVERPKVKEVTALGAAYLAGLATGFWKDLSELRDKASIEKTFVPDGDEAKR
TRRYKGWKKAVKRALEWEKEEE
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgacggataaaaaatatatcattgccctagatcaaggtaccacaagttcaagagccgtt
ctccttgatcatgatgcgaatattgttgaaattgcccaacgtgaatttacgcaaatttat
ccacaggctggctgggttgaacataatcccatggagatttgggcaacacaaagttccacc
ttaaatgaagtggtcgcgaaagccggtatcactgctgatcaaatcgcggcaattgggatc
actaatcagcgtgaaaccacgattgtatgggaaaaagaaaccggtaagccaatttacaat
gcgattgtgtggcaatgccggcggacgactgagataaccgataaactgaaagcagatggt
cacgaagactatatacgtcaaacgacaggcttagtggtagatccttacttctctggaacc
aaaattaaatggattttggataacgtggaaggggcacgggaacaagcagaacgtggcgaa
ttactctttggtacggtggatacttggctagtatggaaattaactcaagggcgtgcacat
gtcactgattacactaacgcctcgcggacgatgttatttaatattcatactctgcaatgg
gacgataacatgctggcgattttaggtatcccacgtgctatgttgcctgaggtgcgtaat
tcttctgaaatatatggtcaaaccaatatcggtggcaaaggtggcgtacgtattcctgta
gccggtatggcaggagatcaacaagcggccttatatggtcatctttgtgttaatgcggga
caagcgaaaaacacttatggtaccggttgtttcatgttaatgcatacgggcgacaaagcc
gtacaatcacaaaatggcttattaaccaccattgcctgtaatgccaaaggtgagcctgca
tatgctctcgaaggctccatcttcatgggcggggcatccattcaatggctacgcgatgag
ctcaaaattgtgcatgatagctatgactcagaatattttgccacccgagtacctgattgt
aatggtgtctatgtggtacctgcctttaccggattaggtgcaccttattgggatccctat
gcacgcggtgccatttttgggctctcacgtggtgcaaatcgcaaccacattgtgcgcgct
actttagaatccattgcataccaaactcgcgatgtgctagaggcgatgcaatctgactca
ggacaaacactgcaagcgctccgtgtggacggtggagcaacggaaaataatttcttaatg
cagttccaagcggatattctcgccaccaaagtagaaagaccaaaagtgaaagaagtcacg
gcattaggcgccgcctatcttgcaggtcttgcgacgggtttctggaaagatctcagtgaa
ttgcgtgataaagccagcatcgagaaaacttttgttcccgatggagatgaagccaaacgc
actcgccgttataaaggctggaaaaaagcagtcaaacgtgcgctcgaatgggaaaaagag
gaagagtag

DBGET integrated database retrieval system