KEGG   Pasteurella multocida 36950: Pmu_17060Help
Entry
Pmu_17060         CDS       T01729                                 

Gene name
adhE
Definition
aldehyde-alcohol dehydrogenase (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
pmp  Pasteurella multocida 36950
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pmp00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Pmu_17060 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pmu_17060 (adhE)
   00620 Pyruvate metabolism
    Pmu_17060 (adhE)
   00650 Butanoate metabolism
    Pmu_17060 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    Pmu_17060 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Pmu_17060 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Pmu_17060 (adhE)
   00626 Naphthalene degradation
    Pmu_17060 (adhE)
Enzymes [BR:pmp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Pmu_17060 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Pmu_17060 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1824836..1827460
Genome map
AA seq 874 aa AA seqDB search
MSHTAEIEISPAQAEVNVLVEKGLLALEAFRQLNQQQVDYIVAKASVAALDQHGVLAMHA
YEETGRGVFEDKATKNLFACEYVVNNMRNLKTVGVISEDDVTGITEIADPVGVVCGITPT
TNPTSTTIFKALISLKTRNPIVFAFHPSAQQCSAHAARVVYEAAVAAGAPEHCIQWIETP
SMEGTAALMKHPGIATILATGGNAMVEAAYSCGKPALGVGAGNVPAYVEKSANIKQATHD
IVMSKAFDNGMICASEQAAIVDQEVYDEFVAEMQSYGAYFVNKKEKALLETFLFGVKANS
TNCANAKLNAAVVGKPATWIAEQAGFKVPEKTNILVAACQEVGENEPLTREKLSPVLAIL
KSTSTEHGFALSEAMVNFHGLGHSAAIHTKEASIAKAFGERVKAIRVIWNSPATFGGIGD
VYNAFLPSLTLGCGSYGKNSVGNNVSAANLLNIKRVGRRRNNMQWFKVPSKIYFERDSIQ
YLQSMKGMERVVIVTDRTMVDLGFVEKIAKQITARGNHVTYQLFADVEPDPSIETVRRGA
ALIRNYQPDTIIALGGGSAMDAAKVMWLFYEQPEVDFRDLVQKFMDIRKRAFKFPQLGRK
ARFIGIPTTSGTGSEVTPFAVITEGDKKYPIADYSLTPTVAIVDPAFVMSVPAHVAADTG
LDVLTHATEAYVSVLANDFTDGLALQAIKLVFEHLERSVKDKDPEAREKMHNASTMAGMA
FANAFLGMNHSLAHKIGGRFHTPHGRTNAVLMPHVIRYNGTRPQKTATWPKYNYYKADVK
YQDIARMLGLPCATPEEGVKSFAQACYDLAIRVGIKMSFKEQGIDEKEWMDARRQVALLA
FEDQCSPANPRLPVVSDMEVILTNAYYGYDANQY
NT seq 2625 nt NT seq  +upstreamnt  +downstreamnt
atgagtcatactgctgaaattgaaatcagcccagcacaagcagaagtgaatgtactggtt
gaaaaaggattgctggcattagaagcattccgtcagcttaatcaacagcaagtggattac
attgtggcaaaagcctcagtagctgctttagatcaacatggggtgcttgctatgcatgct
tatgaagaaacaggacgcggggtatttgaagataaagctaccaaaaatctgtttgcctgt
gaatatgtagtcaacaatatgcggaatttgaaaaccgtgggggtgatcagtgaggatgat
gtcacagggatcaccgaaattgcagaccctgttggcgtggtttgcggaattaccccaacg
accaacccgacgtccaccaccattttcaaagcccttatctcactaaaaacccgtaacccc
atcgtctttgcattccatccttccgcacaacaatgttctgctcatgcggcacgcgtagtc
tatgaggcagccgttgcagcgggggcgccagaacattgtattcaatggattgaaaccccg
tcgatggaaggtaccgcagcgctgatgaaacaccctggcattgctaccattcttgctacg
ggcggcaatgcgatggttgaggcggcgtattcttgtggtaaaccagctcttggcgtagga
gcgggtaacgtacctgcttatgtggaaaaaagcgcaaatatcaaacaagctacgcatgat
attgtgatgtcaaaagcctttgataacggcatgatttgtgcctctgaacaagccgccatt
gtcgatcaagaggtgtacgatgaatttgtggcagaaatgcagtcttatggtgcttacttt
gtaaataaaaaagaaaaagccttgttagaaacatttcttttcggcgtcaaagccaacagt
acaaattgtgctaacgcaaaattaaatgctgcggttgtgggaaaacctgccacatggatc
gccgaacaagcgggcttcaaagtgccagaaaaaaccaatattttggtggcagcctgtcaa
gaagtgggcgaaaacgaaccccttacccgtgaaaaactttccccagtcctcgcgatatta
aaatccacgtcaacagaacatggctttgcgttatctgaagccatggtgaatttccatggt
ttaggacattccgccgccattcatactaaagaggcaagcattgccaaagcctttggcgaa
cgcgtgaaagccattcgtgtgatctggaactcgcctgcgacctttgggggcattggcgat
gtgtataatgccttcctcccgtcactcacactcggttgtggttcctacgggaaaaactcc
gtcggtaacaatgtcagtgcagccaatttattaaatattaaacgtgtgggaagacggaga
aataacatgcaatggttcaaagtgccttcaaaaatctattttgaacgcgattcaattcaa
tatttacaatcaatgaaaggcatggaacgcgtggtgattgtcactgacagaaccatggtg
gatctaggctttgtggaaaaaattgctaaacaaattaccgcgcgtggtaaccatgtgacc
taccaattgtttgctgatgtagaacctgatccatctatcgaaacggtacgccgtggcgca
gcattaattcgcaactaccaacccgatacgattattgcgttaggtggtggatcggcaatg
gatgcagcaaaagtcatgtggttgttctatgaacaacctgaagtggatttccgtgattta
gtccaaaaattcatggatattcgcaaacgggcgttcaaattcccacaattagggcgcaaa
gcgcgctttatcggcattccaacgacttcaggcacaggttcagaagtcacgccctttgcg
gtcatcaccgaaggcgataaaaaatacccgatcgctgactactcgctcaccccaacagtc
gccattgtggatccggcttttgtgatgagtgtgccggcacatgtcgctgcggataccgga
ctagacgtgttaacccatgccacggaagcttatgtgtcagtgctcgccaacgactttacc
gacggtttagccctacaagcgatcaagctcgtgtttgaacatttagaacgctccgtgaaa
gacaaagatcccgaagcgcgtgaaaaaatgcacaatgcgtccaccatggcagggatggca
tttgctaacgccttcttaggcatgaaccactcccttgcacacaaaattggcgggcgtttc
cacactccacatggtcgtaccaatgcggtcttaatgccacatgtgattcgttataacggc
acacgtccacaaaaaacggcaacgtggccaaaatacaattactacaaagcggatgtgaaa
taccaagatatcgcgcgtatgctcggtttaccttgtgccacaccggaagaaggggtgaaa
tcctttgcacaagcgtgctatgacttagccattcgcgtgggtatcaagatgtccttcaaa
gagcaaggtattgatgaaaaagaatggatggacgctcgtcgccaagtcgcgttactcgcc
tttgaagaccaatgttcgccagccaacccacgtttacctgtagtaagcgatatggaggtg
atcttaaccaatgcctactatggttatgatgccaatcaatactaa

DBGET integrated database retrieval system