KEGG   Pasteurella multocida 36950: Pmu_19000Help
Entry
Pmu_19000         CDS       T01729                                 

Gene name
pldB
Definition
lysophospholipase L2 (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
pmp  Pasteurella multocida 36950
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:pmp00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2023009..2023962)
Genome map
AA seq 317 aa AA seqDB search
MIREPHFTHFALAELHPFAAQFPLQDVQGKKGVRITYRHFVQDNPVQRNLVILVNGRAEN
LLKWTELAYDFYQQGYDVLVFDHRGQGYSQRLLPDHEKGYIDEFRFYADDMAILLAKISA
LYPYENQHILAHSLGALISTYYLANYDHQVKSAVFSAPFYGIPLKHSFRDELIINLMMLL
GQGSRYVFGKGRYQPADLDNNDLSCCRTRMRWMNRINRRYPHIHLGGPTFRWVHLCFSAI
KKLPTILPRIEIPVLILQSEKEKIVENKNLRKLTALLPRGELTQIAQSKHEILFERDLIR
SEALKKISQFFTANSAK
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgatccgtgaaccccattttactcactttgccttggctgaattacatccttttgcagca
caatttccgttgcaagacgtacaagggaaaaaaggggtacgtattacctatcggcatttt
gtacaagacaatcccgtacagcgtaatttggtgattttagtcaatggacgtgcagaaaac
ttattgaaatggactgaactggcttatgatttctatcaacaaggctacgacgttttggta
tttgatcatcgtgggcaaggctattcacagcgtttattgccagatcatgagaaaggttat
attgatgagtttcgtttttatgcggacgatatggcaattttattagcgaaaatcagcgca
ctttatccttatgaaaatcaacatattctcgcccattccttaggtgcattgattagtact
tattaccttgccaattacgatcatcaggtgaaaagtgcggtcttttctgcgccattttat
ggcattcctctcaaacattctttccgagatgagctcattattaatctaatgatgttatta
ggtcagggttcacgctatgtgtttggcaaaggacgttatcaaccggcggatttggataat
aatgatttaagttgttgtcgaactcgtatgcgctggatgaatcgaattaatcgtcggtat
ccgcatattcatttagggggaccgaccttccgttgggtgcatttatgttttagtgccatt
aaaaaattaccgactattttgccgcgtattgagattcctgtgctgattctacaatcggag
aaagaaaagattgtggaaaataaaaatctgcgcaaactcaccgcacttttaccacgagga
gagttaacacaaattgcgcaaagtaaacacgaaattttatttgagcgtgatcttatccgc
tccgaggcactcaagaaaattagccaattttttactgccaatagcgccaaataa

DBGET integrated database retrieval system