KEGG   Pasteurella multocida 36950: Pmu_19500Help
Entry
Pmu_19500         CDS       T01729                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pmp  Pasteurella multocida 36950
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Pmu_19500 (galU)
   00052 Galactose metabolism
    Pmu_19500 (galU)
   00500 Starch and sucrose metabolism
    Pmu_19500 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    Pmu_19500 (galU)
Enzymes [BR:pmp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Pmu_19500 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2075369..2076256
Genome map
AA seq 295 aa AA seqDB search
MKAIIPVAGLGTRMLPATKAIPKEMLTLVDKPLIQYVVNECVAAGMKEIVLVTHSSKNAI
ENHFDISFELETMLEKRVKRQLLDEVRSICPKNVTIMHVRQGNAKGLGHAVLCGRPLVGN
EPFAVILPDVLLADFSADQKRENLAAMVKRFEETQTSQIMVAPVAEKEVSSYGIVDCGGA
DLKGGESTKIHSIVEKPSLDKAPSNLAVVGRYVFSAAIWDLLEKTPIGVGDEIQLTDAID
MLIEKEVVEAFHMTGKSFDCGDKIGYMQAFVEYGLQHDKLGQQFKAYLQQLVKSF
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaattatccccgtcgcaggtttagggacacgaatgttacccgcgacaaaggcg
attcctaaagaaatgttaacgctggtagataagccgttaattcaatatgttgtgaatgaa
tgcgtggctgctggtatgaaggaaattgtcttggtgacacattcttcaaaaaatgccatt
gaaaaccattttgatatctcatttgaattggagacaatgctagaaaaacgtgttaaacgt
caacttttagatgaggttcgctcgatttgtccaaaaaatgtgacaattatgcatgtccgt
caaggtaatgcgaaaggcttaggacatgccgttttatgtggcagaccattagttggaaat
gagccatttgctgtgattctaccggatgtactattggctgatttttcagcggatcaaaaa
cgtgagaatctggctgcaatggtcaaacgttttgaggaaacacaaacgagccagattatg
gttgcgcctgttgctgaaaaagaggtcagtagctacggtatcgtagattgtggcggagct
gatttaaaaggtggcgaaagtacaaaaattcatagcattgttgagaaaccgagtttagac
aaagccccttctaatttagcggtggttggacgttacgttttctcagcggcaatttgggac
ttgttggaaaaaactccgattggtgtcggcgatgaaattcaattaaccgatgcgattgat
atgttgattgaaaaagaagtcgttgaagcgttccatatgacaggaaaatccttcgattgt
ggtgataaaattggttatatgcaagcgtttgtggagtatggattgcagcatgataaatta
ggtcagcaattcaaagcgtatttgcaacagctcgtcaaaagtttttaa

DBGET integrated database retrieval system