KEGG   Pasteurella multocida 36950: Pmu_19740Help
Entry
Pmu_19740         CDS       T01729                                 

Gene name
tpiA1
Definition
triosephosphate isomerase-1 (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pmp  Pasteurella multocida 36950
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pmp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pmu_19740 (tpiA1)
   01230 Biosynthesis of amino acids
    Pmu_19740 (tpiA1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pmu_19740 (tpiA1)
   00051 Fructose and mannose metabolism
    Pmu_19740 (tpiA1)
   00562 Inositol phosphate metabolism
    Pmu_19740 (tpiA1)
Enzymes [BR:pmp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Pmu_19740 (tpiA1)
Exosome [BR:pmp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Pmu_19740 (tpiA1)
  Exosomal proteins of bladder cancer cells
   Pmu_19740 (tpiA1)
  Exosomal proteins of melanoma cells
   Pmu_19740 (tpiA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2103052..2103837)
Genome map
AA seq 261 aa AA seqDB search
MARRPLVMGNWKLNGSKAFTKALIEDLKTELAGVEGCDVAIAPPVMYLAEAEAALKCSCS
CGGKAIALGAQNVDVNVQGAFTGDISTEMLKDFGAKYIIIGHSERRTYHKESDEFIAKKF
AALKQAGLVPVLCIGESEAENEAGKTEEVCARQIDAVLNTLGAEAFNGAVIAYEPIWAIG
TGKSATPAQAQAVHAFIRGHIAKKDNAVAEQVIIQYGGSVNDANAAELFTQPDIDGALVG
GASLKAPAFAVIVKAAAKAKN
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtcgtcctttagttatgggtaactggaaattaaacggtagcaaagcattcacc
aaagcattaatcgaagacttaaaaacagaattagcgggtgttgaaggctgcgatgtggca
attgccccaccggtgatgtatttagcagaagcagaagctgccttaaaatgcagttgtagt
tgtggcggaaaagccattgcccttggtgcacaaaacgtcgatgtgaatgtacaaggcgcc
tttactggcgatatttcaacagaaatgctgaaagattttggtgcaaaatatatcattatc
ggtcactctgagcgtcgtacttatcataaagaaagcgatgaattcatcgcgaaaaaattc
gcagcattaaaacaagcaggcttagtgccggtattgtgtatcggtgaaagtgaagccgaa
aatgaagcgggcaaaacagaagaagtatgcgcacgccaaattgatgccgtattaaataca
ttaggcgctgaagcctttaatggtgccgttatcgcttatgagccaatttgggcaatcggt
accggtaaatcagcaacccctgctcaagcacaagcagttcatgcctttatccgcggtcat
atcgcgaaaaaagacaacgcggtggcagaacaagtgattatccaatacggtggttcagtt
aatgatgcgaatgcggctgaattatttactcaacccgatatcgacggtgcattagttggt
ggtgcctcattaaaagcccctgcctttgccgtgatcgtcaaagccgcagcaaaagcaaaa
aactaa

DBGET integrated database retrieval system