KEGG   Pasteurella multocida 36950: Pmu_20860Help
Entry
Pmu_20860         CDS       T01729                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
pmp  Pasteurella multocida 36950
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Pmu_20860 (hemB)
Enzymes [BR:pmp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Pmu_20860 (hemB)
Exosome [BR:pmp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Pmu_20860 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2211709..2212734)
Genome map
AA seq 341 aa AA seqDB search
MTQQIFASFPQRRLRRMRKQAFSRRLMAENKLSVEDLIYPVFIIEGEKQREPVPSMPGVE
RLTIDELLIEAELLVKYGVPVIALFPVIAQEKKSLMAEEAYHPDGLVQRAVKALKDKFPT
ELGILTDIALDPYTTHGQDGIIDQHGYVLNDVTSDILVKQALSHAKAGADIVAPSDMMDG
RIGKIRHALEEKGFINTLIMAYSAKYASHYYGPFRDAVGSATNLKGGDKKTYQLDPANSD
EGLQEVALDLQEGADMVMVKPGMPYLDLVYRVKTHFGVPTFAYQVSGEYAMHQAAIQNGW
LKEKECIMESLLCFKRAGADGILTYYAKQVAEWLYWDKQHQ
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacaaatttttgccagtttccctcaacgtcgcctacgccgtatgcggaaacaa
gctttcagtcgccgtttaatggcagaaaataaactcagcgtagaggatttaatttatccc
gtttttattattgaaggcgaaaagcaaagggaacccgtaccttccatgcctggtgtagaa
cgcttaaccattgatgagctattaattgaagccgaacttttagtcaaatatggggtaccg
gtgattgcgcttttcccggtgattgcacaagagaaaaaatccttaatggcagaagaagct
tatcatcctgatggcttagtacagcgcgcggtaaaagcattaaaggacaaattcccaact
gaacttggcatacttactgatattgccctcgatccctatactacacatggacaagacggg
ataattgatcaacatggctatgtattaaatgatgtcactagcgatattttagtcaaacaa
gcgctttcccatgcgaaagcgggcgcagatattgtagcaccaagcgatatgatggatggt
agaattggcaaaattcgccatgccctcgaggaaaaggggtttatcaatacactcattatg
gcgtattctgccaaatatgcttctcattattatggacctttccgcgatgccgtcggttct
gccaccaatttaaaagggggcgataaaaaaacttatcaattagatccggccaatagtgat
gaaggactacaagaagtggcattagatttacaagaaggggcagatatggtgatggtcaaa
cccggcatgccgtatttagatttggtttatcgcgtgaaaacccattttggcgtgccaact
ttcgcttaccaagtatcgggtgagtatgccatgcatcaagctgcgatccaaaacggctgg
ctcaaagaaaaagaatgtattatggaatctttattgtgcttcaaacgtgctggcgccgat
gggattttgacgtattacgccaaacaagtagcagaatggctatattgggacaaacaacat
caataa

DBGET integrated database retrieval system