KEGG   Pasteurella multocida 36950: Pmu_21400Help
Entry
Pmu_21400         CDS       T01729                                 

Gene name
tpiA2
Definition
triosephosphate isomerase-2 (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pmp  Pasteurella multocida 36950
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:pmp01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pmp01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pmp00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pmp00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:pmp00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2262217..2263266
Genome map
AA seq 349 aa AA seqDB search
MEKKIYFGTNLKMYKGNCETVDYLTQLLALREKLQSDYDIELFVIPSYIALKDAVHAAAS
ETTHKILIGAQNMNAKDKGQFTGEISPLMLKELGVQLVMIGHSERRHVLKETDQEENEKV
LSALKHGFKTLLCVGETLEQKNYQISDEVLRTQLKIGLHGVSVKQLPHLFIAYEPVWAIG
EGGIPATAQYADEKQKIIKQCLFEMFGEESKKIPVLYGGSVNLENANELIMQPHIDGLFV
GRSAWDAQCFYTLIDGALKALAGTTHQFSPIATQLIKHLGGKENISALTHCASRIRVMTR
NENHINKVAIEKINGVSGLFSIANQYQIIVGPKWVEKIYSEMKALLETE
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaaaaatttactttggtacaaatttaaaaatgtataaaggtaattgtgaaaca
gtcgattaccttactcagttacttgccctcagagaaaaacttcaatctgattatgatatt
gaattatttgtcattccttcttatatcgccttaaaagatgctgtacatgcagcggcatca
gagacaacgcataaaattcttattggtgcacagaacatgaatgctaaggataaggggcag
tttactggcgaaatttcaccactcatgttgaaagagctaggggttcagttggtcatgatt
gggcattctgaacgtcgccatgttttgaaagaaaccgatcaggaagagaatgagaaagta
ttgtcagcgttgaagcatggctttaaaacattactctgtgttggtgaaacgttagaacag
aaaaattatcagatttccgatgaagtacttcggacacaattaaagatcggtttgcacggt
gtatcagtgaagcaattacctcatttattcattgcatatgaacccgtttgggcaattggt
gaaggtggtattcctgcaacagcgcaatatgcagatgagaaacagaagatcattaaacaa
tgtttatttgaaatgtttggtgaggaaagtaaaaagataccggtattgtatgggggaagt
gtgaatttagaaaatgcaaatgaattaattatgcagcctcatattgacggattgtttgtt
gggcgtagcgcctgggatgcacaatgtttttatactttaatagacggtgcgttaaaagcc
ttggcgggtacaacacatcaatttagccctattgctactcagctcattaaacacttagga
ggaaaagaaaatatcagtgcgttaacgcattgtgcgagtcggattagagtgatgacgcgg
aatgaaaatcatataaataaagtagcaatagaaaaaataaatggggtgagcgggttattt
tcgatcgctaatcaatatcaaattattgtaggtcctaaatgggtagaaaaaatttatagc
gaaatgaaagcgttattagaaacagaatag

DBGET integrated database retrieval system