KEGG   Pasteurella multocida 36950: Pmu_21400Help
Entry
Pmu_21400         CDS       T01729                                 

Gene name
tpiA2
Definition
(GenBank) triosephosphate isomerase-2
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pmp  Pasteurella multocida 36950
Pathway
pmp00010  Glycolysis / Gluconeogenesis
pmp00051  Fructose and mannose metabolism
pmp00562  Inositol phosphate metabolism
pmp01100  Metabolic pathways
pmp01110  Biosynthesis of secondary metabolites
pmp01120  Microbial metabolism in diverse environments
pmp01130  Biosynthesis of antibiotics
pmp01200  Carbon metabolism
pmp01230  Biosynthesis of amino acids
Module
pmp_M00002  Glycolysis, core module involving three-carbon compounds
pmp_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pmp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pmu_21400 (tpiA2)
   00051 Fructose and mannose metabolism
    Pmu_21400 (tpiA2)
   00562 Inositol phosphate metabolism
    Pmu_21400 (tpiA2)
Enzymes [BR:pmp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Pmu_21400 (tpiA2)
Exosome [BR:pmp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Pmu_21400 (tpiA2)
  Exosomal proteins of bladder cancer cells
   Pmu_21400 (tpiA2)
  Exosomal proteins of melanoma cells
   Pmu_21400 (tpiA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM PTS_EIIB
Motif
Other DBs
NCBI-ProteinID: AET16984
Position
2262217..2263266
Genome map
AA seq 349 aa AA seqDB search
MEKKIYFGTNLKMYKGNCETVDYLTQLLALREKLQSDYDIELFVIPSYIALKDAVHAAAS
ETTHKILIGAQNMNAKDKGQFTGEISPLMLKELGVQLVMIGHSERRHVLKETDQEENEKV
LSALKHGFKTLLCVGETLEQKNYQISDEVLRTQLKIGLHGVSVKQLPHLFIAYEPVWAIG
EGGIPATAQYADEKQKIIKQCLFEMFGEESKKIPVLYGGSVNLENANELIMQPHIDGLFV
GRSAWDAQCFYTLIDGALKALAGTTHQFSPIATQLIKHLGGKENISALTHCASRIRVMTR
NENHINKVAIEKINGVSGLFSIANQYQIIVGPKWVEKIYSEMKALLETE
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaaaaatttactttggtacaaatttaaaaatgtataaaggtaattgtgaaaca
gtcgattaccttactcagttacttgccctcagagaaaaacttcaatctgattatgatatt
gaattatttgtcattccttcttatatcgccttaaaagatgctgtacatgcagcggcatca
gagacaacgcataaaattcttattggtgcacagaacatgaatgctaaggataaggggcag
tttactggcgaaatttcaccactcatgttgaaagagctaggggttcagttggtcatgatt
gggcattctgaacgtcgccatgttttgaaagaaaccgatcaggaagagaatgagaaagta
ttgtcagcgttgaagcatggctttaaaacattactctgtgttggtgaaacgttagaacag
aaaaattatcagatttccgatgaagtacttcggacacaattaaagatcggtttgcacggt
gtatcagtgaagcaattacctcatttattcattgcatatgaacccgtttgggcaattggt
gaaggtggtattcctgcaacagcgcaatatgcagatgagaaacagaagatcattaaacaa
tgtttatttgaaatgtttggtgaggaaagtaaaaagataccggtattgtatgggggaagt
gtgaatttagaaaatgcaaatgaattaattatgcagcctcatattgacggattgtttgtt
gggcgtagcgcctgggatgcacaatgtttttatactttaatagacggtgcgttaaaagcc
ttggcgggtacaacacatcaatttagccctattgctactcagctcattaaacacttagga
ggaaaagaaaatatcagtgcgttaacgcattgtgcgagtcggattagagtgatgacgcgg
aatgaaaatcatataaataaagtagcaatagaaaaaataaatggggtgagcgggttattt
tcgatcgctaatcaatatcaaattattgtaggtcctaaatgggtagaaaaaatttatagc
gaaatgaaagcgttattagaaacagaatag

DBGET integrated database retrieval system