KEGG   Pasteurella multocida 36950: Pmu_21910Help
Entry
Pmu_21910         CDS       T01729                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
pmp  Pasteurella multocida 36950
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pmp01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:pmp00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2314547..2315845)
Genome map
AA seq 432 aa AA seqDB search
MQTLIWNTLNSAQKQAALSRPAQAVGEQITQAVNAIKSNVINNGDKALFELAEKFDKTTL
ESLVISKAQIEQASQRIATELKQAIQTAKGNIERFHQAQKNQTVDLETQAGVRCQVVTRP
IQNVGLYIPGGSAPLFSTVLMLAVPAKIAGCKTIVLCSPPPIADEILYTANLCGVETIYA
IGGAQAIFAMANGTETVQKVDKIFGPGNAFVTEAKRQVLQQGTAIDMPAGPSEVLVIADE
FADPDFVASDLLSQAEHGADSQVILVTNCETLAKQTALSIEQQLARLPRAETARKALAHS
RTFIAEDLQQCVEISNAYAPEHLVVQVENARNLLPFLDNAGSIFLGAYSPESMGDYASGT
NHVLPTYGYTRTHSSLGLADFSKRMTVQELTPQGFKDLANTVMLMAEAEQLEAHKQAVEI
RWRKLQGKQNCA
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacacttatttggaatacgttaaattcagcacaaaaacaagctgcactttctcgc
ccagctcaagccgttggtgaacaaattacgcaagccgtgaatgcgatcaaaagcaatgtc
atcaacaatggggataaggcattatttgaacttgcggaaaaattcgataagaccacatta
gaaagccttgtcatctcaaaagcccaaattgagcaagcgagccagcgtattgcgacggaa
ttaaaacaagcgattcaaaccgccaaaggcaatattgaacgtttccaccaagcacaaaaa
aaccaaacggtggatctggaaacccaagccggtgtgcgttgccaagtcgttactcgcccc
attcaaaacgtcggtttatatatccccggtggctctgctccgctgttttccacggtatta
atgcttgctgttcctgccaaaattgccggctgtaaaaccattgtgctgtgttccccacca
cctattgccgatgaaattctttacaccgccaatttatgtggtgttgaaaccatttatgct
atcggaggcgctcaagccatttttgccatggcaaacggcacggaaacggtgcagaaagtg
gataaaattttcggtccgggcaatgcctttgtcactgaagccaaacgtcaagtattacaa
caaggcactgcgattgatatgccagccggtccctctgaagtgttagtgattgccgatgaa
tttgccgatcccgattttgtcgccagcgatttactttctcaagcggaacatggcgcagac
agccaagtgattttagtcactaattgtgaaacgttagcaaaacagaccgcactttccatt
gagcaacaactggctcgtttaccaagagcagaaacggctcgtaaggcgcttgctcacagt
cgcacctttatcgccgaagatctgcaacaatgtgtagaaattagtaatgcttatgcgcct
gaacacttggtcgtacaggtggaaaatgcgcgtaacttactgccgtttttagataacgcc
ggctcgattttcttaggtgcctattcacctgaaagtatgggcgattatgctagtggtacc
aatcacgttctaccgacctacggctatactcgcacccattcaagtttaggtttagccgat
tttagcaaacggatgacagtacaagaactcaccccacaaggctttaaagatctcgcgaac
acggtgatgttaatggcagaagcagaacaattagaagcgcataagcaagcagtagaaatt
cgttggagaaagttgcaaggaaagcagaattgtgcataa

DBGET integrated database retrieval system