KEGG   Paenibacillus mucilaginosus 3016: PM3016_1340Help
Entry
PM3016_1340       CDS       T01757                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pmq00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PM3016_1340
Enzymes [BR:pmq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PM3016_1340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1534311..1535219
Genome map
AA seq 302 aa AA seqDB search
MKRPRIAVVGSLNMDLVVSMPRMPQVGETVHGTDIHYIPGGKGANQAVGCARLGAEVSMI
GAVGSDHFGREMLERLQEEGIDLGGVHTAEGPTGTAAIFHTAEDNCIAVVPGANAYCTPE
LVERHRERIESADVLLVQLEVPLDTVHRALEIARQAGVRTVLNPAPAKVLPAPLLSLADI
LTPNETEFALLSGEQDTSEEVLRRVMIAWQQDYGHTVILTRGRLGSSWLDEGERLRTEPA
LPVETVDTTGAGDAFNAALCFGLASGWDLQQAADFACRAASVSVTRFGAQAGMPRLEEVP
ER
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtccacgaattgccgtagtcgggagcttgaacatggatctggtcgtatccatg
ccgcggatgccgcaggtgggggagaccgtccatggtacggatatccactatatcccggga
ggcaagggagcgaaccaggcggtcggctgcgcccgtctcggcgcggaggtatcgatgatc
ggagcggtggggagcgatcattttggccgggagatgctggagcggctgcaggaggagggc
atcgacctcggcggtgtccatacggccgaggggcctacgggaaccgcagcgatcttccac
accgcggaggataactgcatcgccgtcgtcccgggggcgaacgcctattgcacgccggag
ctcgttgaacggcacagggagcggatcgagtcggccgacgtgctgctggtccagctggag
gtgccgctggataccgtgcaccgggccctggagatcgcccgccaggccggcgtgcgcacc
gtgctcaacccggctccggccaaggtgctgccggctccgctattgtcgctggccgacatc
ctgacgccgaatgagaccgaattcgccctgctcagcggggagcaggatacctcggaagag
gtgctgcgccgggttatgatcgcctggcagcaggattacggccatacggtgatcctgacg
cgaggacggctgggcagctcctggctggatgagggagagcgcctgcgcaccgagccggcc
ctgcccgtcgagacggtggatacgaccggagcaggcgatgccttcaatgcagcgctgtgc
ttcggcctggcttccggctgggacctgcagcaggccgccgattttgcctgccgggccgca
tcggtatccgtcacccgcttcggcgcccaggccggcatgccccgcctggaggaagtgccg
gagcggtag

DBGET integrated database retrieval system