KEGG   Paenibacillus mucilaginosus 3016: PM3016_1380Help
Entry
PM3016_1380       CDS       T01757                                 

Definition
pyridoxal-5'-phosphate-dependent protein subunit beta
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pmq01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:pmq00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:pmq00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1585466..1586761
Genome map
AA seq 431 aa AA seqDB search
MHLQPRLHTAEEMGAIYLVYKEWKVFFMSRYSYFSHLQCPQCGLIFSGSEVRQLCGCGSP
LLARYDLEALRQVLPRPELEGRETSLWRYHELLPVERPENVVTLGEGMTPLLPLPRLGAA
YDLPHLYMKDEGIIPTGSFKARGATVGLSKAKELGVRQFAMPTNGNAGAAWSLYAARAGI
RASVVMPVDAPMITRGECAASGADLYLVNGLISDAGRLVAGKIASGGIYDASTLKEPYRI
EGKKTMGIEIAEQFGWTLPDVILYPTGGGVGLIGIYKALSELLELGWIEGPLPRLVAVQA
AGCAPIVKAWQEGASRSEFWPNSGTAAFGINVPKALGDFLVLEAVYATGGCAVAVEDEAL
LSEQRLAASLEGAFVCPEGAAAFAAARKLRESGWIRDGERVVVLNTGMGIKYPETIPVNA
PVLQPEDALPS
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
ttgcatctgcagcccaggctgcacacagcggaagagatgggggctatttatttggtttac
aaagaatggaaggtgttcttcatgtcccgttacagttacttctctcatctgcagtgtccc
caatgcggactgatcttctcgggctcggaagtgcggcagctgtgcggatgcggttctccg
ctgctcgcccgctacgatttggaggcgctgaggcaggttctgccccggcccgaactggag
ggaagagagaccagtctttggcgctaccatgaactgcttccggtagagcgtccggagaac
gtggtcacgcttggggaaggaatgaccccgctactccccctgcccaggctcggggcggcg
tatgacctcccccatctttatatgaaagacgaggggatcatccctaccggctcattcaag
gccaggggggcgaccgtcggcctgtcgaaggcgaaggagctgggggtccggcagttcgcc
atgccgacgaacggcaatgccggggcggcctggtccctgtacgcggcccgcgcgggcatc
cgggcgtcggtcgtcatgccggtcgatgcgccgatgattacgcggggcgaatgcgccgct
tccggagccgacctctacctcgtcaacgggctgatcagcgacgccggacggctcgtggcc
ggtaagatcgcctccggcggcatctatgatgcctctacccttaaggagccctaccgcatc
gaaggcaaaaagacgatgggcatcgagatcgccgagcagttcggctggactctgccggac
gtcattctctatccgaccggaggcggcgtcggtctcatcggcatctacaaagcgctcagc
gagctgctggagctcggctggatcgaagggccgctgccccggctggtggccgttcaggcg
gcaggctgcgcgcccatcgtgaaggcctggcaggaaggagcctcccgctcggagttctgg
ccgaactccggtacggccgccttcggcattaatgtgccgaaggcgctcggcgacttcctc
gtgctggaggccgtttacgccaccggcggctgcgctgtcgcagtggaagacgaagccctg
ctgagcgagcagcgtctggcggcatcgctggaaggcgcattcgtctgccctgaaggcgca
gctgccttcgcagcggcccggaaactgcgcgagagcggatggattcgggacggggagcgg
gtggtcgtcctgaatacgggcatgggcatcaagtatccggagacgataccagtgaatgcc
cccgtacttcagccggaggatgcgctcccgtcatga

DBGET integrated database retrieval system