KEGG   Paenibacillus mucilaginosus 3016: PM3016_1380Help
Entry
PM3016_1380       CDS       T01757                                 

Definition
(GenBank) Pyridoxal-5'-phosphate-dependent protein subunit beta
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
pmq00260  Glycine, serine and threonine metabolism
pmq00750  Vitamin B6 metabolism
pmq01100  Metabolic pathways
pmq01110  Biosynthesis of secondary metabolites
pmq01120  Microbial metabolism in diverse environments
pmq01230  Biosynthesis of amino acids
Module
pmq_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pmq00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PM3016_1380
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PM3016_1380
Enzymes [BR:pmq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PM3016_1380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFC28306
UniProt: H6NCB3
Position
1585466..1586761
Genome map
AA seq 431 aa AA seqDB search
MHLQPRLHTAEEMGAIYLVYKEWKVFFMSRYSYFSHLQCPQCGLIFSGSEVRQLCGCGSP
LLARYDLEALRQVLPRPELEGRETSLWRYHELLPVERPENVVTLGEGMTPLLPLPRLGAA
YDLPHLYMKDEGIIPTGSFKARGATVGLSKAKELGVRQFAMPTNGNAGAAWSLYAARAGI
RASVVMPVDAPMITRGECAASGADLYLVNGLISDAGRLVAGKIASGGIYDASTLKEPYRI
EGKKTMGIEIAEQFGWTLPDVILYPTGGGVGLIGIYKALSELLELGWIEGPLPRLVAVQA
AGCAPIVKAWQEGASRSEFWPNSGTAAFGINVPKALGDFLVLEAVYATGGCAVAVEDEAL
LSEQRLAASLEGAFVCPEGAAAFAAARKLRESGWIRDGERVVVLNTGMGIKYPETIPVNA
PVLQPEDALPS
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
ttgcatctgcagcccaggctgcacacagcggaagagatgggggctatttatttggtttac
aaagaatggaaggtgttcttcatgtcccgttacagttacttctctcatctgcagtgtccc
caatgcggactgatcttctcgggctcggaagtgcggcagctgtgcggatgcggttctccg
ctgctcgcccgctacgatttggaggcgctgaggcaggttctgccccggcccgaactggag
ggaagagagaccagtctttggcgctaccatgaactgcttccggtagagcgtccggagaac
gtggtcacgcttggggaaggaatgaccccgctactccccctgcccaggctcggggcggcg
tatgacctcccccatctttatatgaaagacgaggggatcatccctaccggctcattcaag
gccaggggggcgaccgtcggcctgtcgaaggcgaaggagctgggggtccggcagttcgcc
atgccgacgaacggcaatgccggggcggcctggtccctgtacgcggcccgcgcgggcatc
cgggcgtcggtcgtcatgccggtcgatgcgccgatgattacgcggggcgaatgcgccgct
tccggagccgacctctacctcgtcaacgggctgatcagcgacgccggacggctcgtggcc
ggtaagatcgcctccggcggcatctatgatgcctctacccttaaggagccctaccgcatc
gaaggcaaaaagacgatgggcatcgagatcgccgagcagttcggctggactctgccggac
gtcattctctatccgaccggaggcggcgtcggtctcatcggcatctacaaagcgctcagc
gagctgctggagctcggctggatcgaagggccgctgccccggctggtggccgttcaggcg
gcaggctgcgcgcccatcgtgaaggcctggcaggaaggagcctcccgctcggagttctgg
ccgaactccggtacggccgccttcggcattaatgtgccgaaggcgctcggcgacttcctc
gtgctggaggccgtttacgccaccggcggctgcgctgtcgcagtggaagacgaagccctg
ctgagcgagcagcgtctggcggcatcgctggaaggcgcattcgtctgccctgaaggcgca
gctgccttcgcagcggcccggaaactgcgcgagagcggatggattcgggacggggagcgg
gtggtcgtcctgaatacgggcatgggcatcaagtatccggagacgataccagtgaatgcc
cccgtacttcagccggaggatgcgctcccgtcatga

DBGET integrated database retrieval system