KEGG   Paenibacillus mucilaginosus 3016: PM3016_1621Help
Entry
PM3016_1621       CDS       T01757                                 

Definition
protein Mutprotein M
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:pmq00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    PM3016_1621
Enzymes [BR:pmq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     PM3016_1621
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     PM3016_1621
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1831483..1832403
Genome map
AA seq 306 aa AA seqDB search
MPELPEVETVRRTLNVLVAGKTIERVSVHLARIIQHPDDIETFKALLEGETIQEVERRGK
FLRIHTDRFTLVSHLRMEGRYGVYEADDPLELHTHVVFHFTDGTELRYKDVRQFGTMHIY
ERGRDLEEKPLKKLGLEPLDEAFTFEAFRSRIAGRKTKIKPLLLNQEYIVGIGNIYVDES
LFLAGIHPEREADTLTKAEMIRLHQAIIQTLTDAVEAGGSSIKSFVNGQGEMGMFQHSFR
VYGRKNRTVPELRTRHREDGGRRPRHAYVSEVPEDETHAQLAYKPGRPRGECTPRPGLPY
SKGETS
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgccggaactgccggaggtagaaacggtccgcaggacgctgaacgtcctcgtggccggc
aagacgatcgagcgggtgtcggtacacctggcgcggattatccagcacccggatgacatc
gagacgttcaaggctcttcttgaaggcgagacgattcaggaggtggagcgcaggggcaaa
ttcctgcgcatccatacggaccgcttcacgctcgtctcccatctgcggatggaaggacgc
tacggggtttatgaagcggatgaccctttggagctgcatacgcatgtcgtgtttcatttt
acggacggcacggagctccggtataaggatgtgcgccagttcggcacgatgcatatctac
gaacgggggcgggacctggaggagaagccgctgaagaagctggggctcgagcctctggac
gaggcgttcaccttcgaagcgttccgcagccggatcgccggccggaagacgaagatcaag
ccgctgctgctcaatcaggaatatatcgtcggaatcgggaatatttatgtggatgaatcc
ctcttcctggcaggcattcaccctgagcgggaagcggacacgctgacgaaagcggagatg
attcggctccaccaggccatcatccagacgcttaccgatgcggtggaggccggcgggtcg
tccatcaagtcgttcgtcaacggccagggggagatgggtatgttccagcacagcttccgc
gtgtacggccgcaagaaccgaaccgtgcccgaactgcggacacgccatcgagaagacggt
ggtcggaggccgcggcacgcatacgtgtccgaagtgccagaagatgaaacgcatgcgcag
ttagcgtataagccaggcaggccccgcggggaatgcacaccccgcccaggactcccatat
agtaagggtgagacgtcctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system