KEGG   Paenibacillus mucilaginosus 3016: PM3016_1744Help
Entry
PM3016_1744       CDS       T01757                                 

Definition
hypothetical protein
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pmq00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    PM3016_1744
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PM3016_1744
   00620 Pyruvate metabolism
    PM3016_1744
   00650 Butanoate metabolism
    PM3016_1744
  Lipid metabolism
   00071 Fatty acid degradation
    PM3016_1744
  Amino acid metabolism
   00350 Tyrosine metabolism
    PM3016_1744
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PM3016_1744
   00626 Naphthalene degradation
    PM3016_1744
Enzymes [BR:pmq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PM3016_1744
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     PM3016_1744
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1965474..1968086
Genome map
AA seq 870 aa AA seqDB search
MAIREKQEEQAKPAAEQEVGRLVAKAIKAQQAFMRLDQAQVDAIVQAMALAGLEQHMKLA
KMAVEETGRGVYEDKITKNLFATEYIYHSIKYDKTVGVIEENPYENYRKVAEPVGVIAGV
TPVTNPTSTTMFKSLIAMKTRNPIIFAFHPSAQKCSAAAARVVVEAAVKAGAPEGCIQWI
EHPSVEATGLLMNHPDVALVLATGGSSMVKAAYSTGKPALGVGPGNVPCFIEKSADLKQA
VTDLILSKTFDNGMICASEQAVIIEEDVYAEVRRLMIGFGCYFLNGEETEAVSKLVINSD
KCAVNAVIVGQPAVKIAQMAGINVPADTKILVAELQGVGPAYPLSAEKLSPVLACYKVKN
AVQGIQRAAEVTAFGGMGHSSVIHSKNDAVIADFAAALKTGRVIVNSPSTHGAIGDIYNT
NLPSLTLGCGSYGHNSTTSNVTAVNLINVKRVAYRTVNMQWFKIPPKVYFEKGATQYLEK
MPDISRILIVTDPMMVQLGYVERVEHYLRKRQTPVAVEVFSDVEPDPSVDTVERGTDLME
RFQPDCIIALGGGSPMDAAKAMWLFYEYPETSFQSLKQKFMDIRKRVYKYPRLGRKAKFV
AIPTTSGTGSEVTSFAVITDKKQGQTKYPLADYELTPDVAIIDPDYVYSLPKTAVADTGM
DVLTHAIEAYVSVMANDYTDGLAMKAIQLVFQNLEKSYATADPVAREKMHNASTIAGMAF
ANAFLGINHSLAHKWGGEFHTAHGRTNAILMPHVIRYNASKPSKFASFPKYDHFVADERY
AEIARMLGLPARTTEEGVNSLVDAVRGLGQAVGIPASFSELGIDPQVFESRVEELADRAF
EDQCTTANPRMPLVSELAEVYRKAFYGRFE
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atggcgattagagagaaacaggaagaacaggcaaagccggcggcggaacaggaagtaggc
cggcttgtcgccaaggcgatcaaggcgcagcaggcattcatgcggctcgaccaggcgcag
gtggacgcgatcgtgcaggcgatggccctcgcggggctcgagcagcacatgaagctcgcg
aagatggccgttgaagagaccggacgcggcgtctacgaagacaagatcacgaagaacctg
tttgcgaccgagtacatctaccacagcatcaagtatgacaaaacggtgggcgtcattgag
gagaatccttacgagaactaccgcaaagtagccgagccggtaggcgtgatcgccggggta
acgccggtcacgaacccgacctccaccacgatgttcaaatctctgatcgccatgaagacc
cgcaatcccatcatcttcgcatttcacccgtccgcacagaaatgcagtgcggctgccgcc
cgcgtcgtcgtggaagcagccgtgaaggcgggcgcaccggaaggctgcatccagtggatc
gagcatccttccgtcgaagcgaccgggctgctcatgaaccatccggatgtggcgctggtc
ctggctaccggcggctcctcgatggtcaaagcggcttacagcacagggaagccggcgctc
ggcgtaggccccggcaacgtgccgtgcttcatcgagaagagcgccgatctcaagcaggcc
gtcacggacctgatcctctccaagacgttcgacaacggtatgatctgcgcctccgagcag
gcggtcattattgaagaggatgtctacgccgaagtgcgccgccttatgatcgggttcggc
tgctacttcctgaacggcgaagagaccgaggcggtatcgaagcttgtcatcaacagcgac
aagtgtgcggtgaacgccgtgatcgtcggccagccggccgtgaagatcgcgcagatggcc
ggcatcaacgttccggccgacacgaagatcctggtcgccgagctgcagggtgtaggtccg
gcttacccgctctccgcggagaagctcagccccgtgctggcgtgctacaaggtgaagaac
gccgtccagggaatccagcgggccgcggaagtgaccgccttcggcgggatgggccactcc
tccgtgatccactcgaagaatgatgcggtgatcgccgactttgccgctgcgctgaagacg
ggccgcgtcatcgtgaattcgccgtccacccacggggcgatcggcgacatctacaacacg
aacctgccttccctgacgctcggctgcggctcctacggccacaattcgacgacctccaac
gttacggcggtcaacctgatcaacgtgaagcgcgtcgcctaccgcaccgtcaatatgcag
tggttcaagattccgccgaaggtctacttcgagaagggcgcgacccagtacctggagaaa
atgcccgacatctcgcgcatcctgatcgtcaccgacccgatgatggtgcagctcggatac
gtggagcgcgtggagcattacctgcgcaagcgccagacgccggtggctgtggaagtattc
agcgacgtcgagccggatccgtcggtggatacggtcgagcgcggcacggatctcatggaa
cgcttccagccggactgcatcatcgccctcggcggcggctccccgatggacgcggcgaag
gccatgtggctcttctacgaatatccggagacgagcttccagtcgctgaagcagaaattc
atggatatccgcaagcgggtgtacaaatatccgcggctcggccgcaaggcgaagttcgtg
gcgattccgacgacgtcgggtacgggctcggaagtcacctccttcgcggtcatcaccgac
aagaagcagggacagaccaaatacccgctggccgactacgagctcacgccggatgtggcg
atcatcgatccggactatgtgtactccctgccgaagacggcggtcgctgatacggggatg
gacgtactgacccacgcgattgaggcgtacgtctcggtgatggcgaacgattatacggac
ggcctggcaatgaaggcaatccagctcgtgttccagaacctcgagaagtcttatgcaacg
gcggatccggtggcccgggaaaaaatgcacaacgcctcgacgatcgccgggatggctttt
gccaacgcgttcctcgggatcaaccactccctggcgcacaagtggggcggcgagttccac
acggcgcacggccgcaccaatgcgatcctgatgccgcacgtcatccgctacaatgccagc
aagccgtcgaagttcgcatccttcccgaaatacgaccacttcgtcgccgatgagcggtac
gccgagatcgcccgcatgctgggactgccggcccgcacgacggaagaaggagtgaacagc
ctcgttgatgcggtccgggggctcggccaggcagtgggcattccggcttcgttctcggag
ctgggcattgacccgcaggtgttcgagagccgggtggaggagctcgccgaccgcgccttc
gaagaccagtgcacgacagccaatccgcggatgccgctggtaagcgagctggcggaggta
taccgcaaggcgttctacggccggttcgaataa

DBGET integrated database retrieval system