KEGG   Paenibacillus mucilaginosus 3016: PM3016_1760Help
Entry
PM3016_1760       CDS       T01757                                 

Definition
(GenBank) transporter
Organism
pmq  Paenibacillus mucilaginosus 3016
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1988807..1989751)
Genome map
AA seq 314 aa AA seqDB search
MPHQTNSSADSHPSPASLASSKGALYRMIAAMAIFGSVGFAAGRTGLQSFELVFVRCICA
VPILGTGWLLSGQFRREAWPVREVLLVLLSGLCLVGNWVFLFRAFEAMPVTVAVSVYYLA
PVFVLLLGSLLFRERLKVSSAVSVAVCAAGTALVSGIGSGAPGEVLSGGLLWALLAALLY
ALVTLLGKGIRRMSPYAVAMLQTAVGVLLLPPLVHFAAFGGLGSSQWLWIALIGAVHTGL
VYYLFFGSLRHLPARTISLLAFLDPGIAMLLDMLITGFRPGLLQIVGIVLLFGGMAVPLW
DRKDRAAQPSALTE
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgccccatcaaaccaactcatccgctgattcgcatccctctccagcctccctcgcttcc
tccaagggagcgctctaccgcatgatcgccgcgatggcgatcttcgggtcggtcgggttc
gccgccggccggacaggcctgcagtccttcgagctcgtcttcgtgcgctgcatctgcgcc
gtgccgatccttgggacgggctggctgctctccggccaattccggcgagaggcctggccg
gtccgcgaggtgcttctcgtgctgctgagcgggttgtgcttagtgggcaactgggtcttc
cttttccgtgcgttcgaagcgatgccggtcaccgttgccgtctcagtgtattacctggcc
ccggtcttcgtgctgctgctcggcagcctgctcttccgcgaacggctgaaggtctcctcg
gccgtatcggtcgccgtctgtgccgccggcacggcgctggtctccgggatcggctccggc
gcgccgggggaagtgctctcgggcggcctcctctgggccctgctggccgcactgctgtac
gcgctggtcacgctgctcggcaagggcatccgccggatgagcccctatgccgtcgcgatg
ctccagacggcggtcggagttcttctcctgccgccgcttgtgcacttcgcggcgttcggg
gggctcgggagcagccagtggctgtggattgccttgatcggtgcggtccataccggcctc
gtctactatctgttcttcgggagccttcggcatctgcccgcgcggacgatctccctcctc
gccttcctggacccggggattgccatgctgctcgacatgctgatcaccggcttccgaccg
ggcctgcttcagatcgtgggcattgtgctcctcttcggaggcatggcggtgcctctgtgg
gatcggaaggacagggcggcgcagccgtctgccctaacggaatag

DBGET integrated database retrieval system