KEGG   Paenibacillus mucilaginosus 3016: PM3016_1761Help
Entry
PM3016_1761       CDS       T01757                                 

Definition
(GenBank) YdaO
Organism
pmq  Paenibacillus mucilaginosus 3016
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1989983..1991809)
Genome map
AA seq 608 aa AA seqDB search
MFASIKRFLIGRPLKSNELGEQKLNKLKALAILSSDALSSVAYGPEQILLVLMTVGAVAF
WYSIPIAVGVLILLTALILSYRQIIFAYPHGGGAYVVSKQNLGIYPGLIAGGSLLVDYIL
TVAVSVSAGTDAITSAFPALHDHTVLIAVAFVIFITLLNLRGVTESASVLAYPVYLFVLA
LFILIGAGLYNIISGSGPSGVHAPLGTPVAGVGLFLLLRAFASGSSALTGVEAISNAIPN
FEDPAPKNAAKTLTAMGLLLGLLFSGIVFLAYYYGITPRPEVTVVSEIAEATFGRNFMYY
FIQGTTALILILAANTGYSAFPLLAVNLAQDKFIPRMFTVRGDRLGYSNGIIILGVLSIL
LIIVFKGQTEHLIPLYAVGVFIPFTLSQTGMMMKWKREKPEGWALKLTINSAGALISLLV
TIMFFLTKFTQVWTVLVFLPLIILLFHRIRKHYEAVGDQLRLTTCEPALTIEGNVMILPV
AGITHVVENSLNYVKSLAPHQIIAVHIPFDRENEAEFQEKWKAWQPDVRLVTLHSPYRSI
IQPLTKFIDTVQRKAGESNYQVTVVIPQFIPKKGWHNILHNQSSLLIRAHLLYRRNVIVT
TVPYHLKK
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcatccatcaagcgattccttataggacggccgttaaagtccaacgaactcggg
gaacaaaaactgaacaaactgaaggccttggccattctttcctcagacgccctctcgtcc
gtcgcttacgggcccgaacaaatcctgctcgtcctgatgaccgtgggtgccgtggccttc
tggtattccattcccattgccgtgggcgtgctgatcctcctgaccgcgctgattctctcc
tacaggcagattatcttcgcttatccgcacggcggaggggcctatgtcgtgtcaaagcaa
aatctcggtatctatcccggattgatcgccggaggctcccttctggtcgactatatcctg
acggtggcggtcagcgtctccgccggcacggatgcgataacgtccgccttcccggcgctg
catgaccacaccgttctgattgccgtggcgttcgtcattttcatcacgctcctgaacctc
agaggggtgacggagtccgcgtcggtcctggcctatccggtgtacctgttcgtgctcgcc
ttattcatcctgattggcgcggggctgtataacatcatctccggcagcggtccgtccgga
gtgcatgcgccgctgggtaccccggtggccggcgtcgggctgttcctcctccttcgggcc
ttcgcctcaggcagctccgccctgaccggggtggaagccatctcgaatgcgatcccgaat
ttcgaggatccggccccgaagaatgcggccaaaaccttgaccgccatgggcctcctgctg
gggctgctgttctcgggcatcgtcttcctggcttactactatgggattaccccccgtccg
gaagtgaccgtggtgtcggagatcgcagaggcgaccttcggaaggaatttcatgtattac
tttatccagggaacgaccgccctgattctcatcctggctgcgaataccggctactccgcc
tttccgctgctggccgtcaatctggcccaggataagttcatcccccggatgttcaccgtg
cggggagaccggctcggctattccaacggcatcatcatccttggcgtgctgtccattctt
ctcattattgtgttcaagggacagaccgagcacctgatcccgctctacgctgtcggtgtt
ttcattccattcaccctgtcgcagacgggcatgatgatgaagtggaagcgggagaagccg
gaaggctgggctctcaaactgacgatcaattcagccggagccctgatcagtctgctcgtc
acgatcatgttctttttgacgaaattcacacaggtgtggacggttctcgtgttcctcccc
ctgatcatcctcctgttccaccgcatccggaagcattacgaagcggtgggagaccagctc
cggctgaccacctgtgagcctgcgctgaccattgaggggaatgtcatgattcttccggtg
gcgggcatcacccatgtggtggagaattcgttgaactatgtcaaatcgctggctccccac
cagatcattgcagtgcacatccctttcgacagggagaatgaagcggagtttcaggaaaaa
tggaaggcatggcagcctgatgtccggctggtcactctgcactccccttaccgaagcatt
attcaaccgctgaccaaattcatcgataccgtgcagcgcaaggccggggaatcgaactat
caagtgacggtagtgatcccccagttcattccgaagaagggctggcataacatcctgcac
aaccagtccagccttctgatccgcgcccacctgctgtaccgccgcaatgtcattgtcacc
acagttccgtatcatctcaaaaaatga

DBGET integrated database retrieval system