KEGG   Paenibacillus mucilaginosus 3016: PM3016_1772Help
Entry
PM3016_1772       CDS       T01757                                 

Definition
(GenBank) PfkB domain-containing protein
  KO
K00847  
fructokinase [EC:2.7.1.4]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Fructose and mannose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmq00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    PM3016_1772
   00500 Starch and sucrose metabolism
    PM3016_1772
   00520 Amino sugar and nucleotide sugar metabolism
    PM3016_1772
Enzymes [BR:pmq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     PM3016_1772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2003981..2004949
Genome map
AA seq 322 aa AA seqDB search
MNWDVTALGEVLIDMTPAGTSDKGYPLYESNPGGAPANVLAALSKLGKRTAFIGKVGADG
FGTYLRDTLQECEIDTSGLIFTEEANTTMAFVHLSADGDRSFSFFRKPGADRLLEAGEVR
GELLAQSRIFHFGSISMTHEPSAEATRFAVSGAKAAGALISYDPNLRMPLWSDAAHAKAM
MEYGLGCADVVKISEEELEFLTGLTDLADGSQQLAERFGIPLILVTLAEKGSFYRFGGAT
GLVPGYAVNTVDTTGAGDAFLGGVLYGLLEKDRRLSELQEEEVRQVVTFANAVGALATTV
KGAIPAMPDLAAIRRLMDSAVS
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaattgggatgtaaccgcactgggggaagtgctgatcgacatgacgccggcaggcaca
tcggacaaaggatacccgctctacgagagcaatcccggcggagcgccggccaacgtgctg
gccgcgctctcgaaactcgggaagcggacggcgttcatcggcaaggtaggggccgacggc
ttcggcacgtaccttcgggatacgctgcaggagtgcgagatcgatacctcgggtcttatt
ttcaccgaggaggcaaacaccacgatggccttcgtccatctcagcgcggacggcgaccgc
tccttcagcttcttccgcaagccgggcgcggaccggctgctggaggcgggggaagtgcgc
ggcgagctgctggcgcagtcgcggatcttccacttcggctcgatctcgatgacgcatgag
ccttcggcggaagcgacgcgattcgcggtgtccggggcgaaggccgcaggagccctgatc
tcctacgatccgaacctgcgcatgcccctctggagcgatgccgcccacgccaaggcgatg
atggagtacgggctcggctgcgccgatgtcgtgaagatctcggaggaagagctggagttc
ctgacgggcctgacggatctggcggacggttcgcagcagctcgccgagcggttcggcatt
cccctgatcctcgtgacgctggccgagaagggaagcttctaccgcttcggcggggcgacc
ggtctggtgcccggctatgccgtgaacacggtcgacacgacaggggcgggagacgcgttc
ctcggcggcgtgctgtacggactgctggagaaggaccgccgtctgtccgaactccaggag
gaggaagtccggcaggtagtcaccttcgccaatgccgtaggcgcactggccacgacggtg
aagggcgcgattccggccatgccggacctcgcggcgatccgccgtctgatggattcggca
gtatcataa

DBGET integrated database retrieval system