KEGG   Paenibacillus mucilaginosus 3016: PM3016_1778Help
Entry
PM3016_1778       CDS       T01757                                 

Definition
(GenBank) two-component response regulator
Organism
pmq  Paenibacillus mucilaginosus 3016
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2010778..2011455
Genome map
AA seq 225 aa AA seqDB search
MITILLVDDDNHIRELMKLSLREEGYRLIEAGDGQAALHCLEEVQVHLVVLDVMMPRMDG
FELCRQIRRKYNDLPVLMVTAKGETGDKVEGFQLGADDYLVKPFDPRELIMRVKSLLRRY
KLAGSDRIQLGRVELDKKGYEVIRGQEHLTLPLKEFELLHMLASHPNQILTRNQLIEGIW
GLDYEGDDRTVDVHIKRLRERFKGEEEGFVIKTIRGLGYKLEVKA
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
gtgatcacgattctgttagtagacgacgacaaccatatccgcgaactgatgaagctcagc
ctgcgggaagagggctaccgcctgatcgaagcgggcgacggacaagccgcgctccactgt
ctggaagaggtgcaggtgcacctggtcgtgcttgacgtcatgatgccccgcatggacggg
ttcgagctgtgccggcagatccgccgcaaatataacgacctgcccgtgctgatggtgacg
gccaaaggagagacgggagacaaggtcgaaggcttccagctcggcgccgacgattatctc
gtcaagccgttcgatccgcgggagctcatcatgcgggtcaagtcgctcctgaggcgctat
aagctcgccgggtccgaccgcattcagctgggaagggtcgagctcgacaagaagggttat
gaagtgatccgcgggcaggagcatctgacgctgccgctcaaggagttcgagctgcttcac
atgctggcaagtcaccctaaccagatcctcacccgcaatcagctcatcgaggggatctgg
gggctggactacgagggggacgaccgcaccgtggatgtgcatatcaagcggcttagggag
cgcttcaagggggaagaggaaggcttcgtgatcaaaacgatccgcggcctcgggtacaag
cttgaggtcaaggcatga

DBGET integrated database retrieval system