KEGG   Paenibacillus mucilaginosus 3016: PM3016_178Help
Entry
PM3016_178        CDS       T01757                                 

Definition
protein HisD
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:pmq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PM3016_178
  Amino acid metabolism
   00340 Histidine metabolism
    PM3016_178
Enzymes [BR:pmq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     PM3016_178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
195243..196535
Genome map
AA seq 430 aa AA seqDB search
MKVMPASEFSLKREVEYGSPEQNEAVQRIIEEVRQDGDAALRRFAQQFDGVNVGDLRVSS
AEIEAAYQQVDEDFLTAIREASVNIRRFHEKQMRTSWMDLQGDGSILGQVIRPLRRVGLY
VPGGKAAYPSSVLMNAIPAQVAGVPEIVMVTPPATAGVEGIDPHILVAAAEAGVKEIYRV
GGAQAVAALAYGTESIPAADKIVGPGNIYVALAKRYVFGAVDIDSIAGPSEIVVLADGSA
DPAYVAADLLSQAEHDEMASAILITPSEDLANAVRTEVELQLQALPRREIAAQSIRDYGA
ILTVSSLEEGVDAVNRLAPEHLEILVADPFQYLSRIENAGAVFLGPYSSEPVGDYFAGPN
HVLPTNGTARFSSPLNVDDFLKKSSVIYYSKEALLRDGEKIMTLARHEGLEAHARAIEIR
LEKEGNRNGQ
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgatgccggcatcggagtttagtctgaagcgggaggtcgagtacggctctccc
gagcaaaatgaggcggttcagcgcattattgaagaggtgcggcaggatggggatgcggct
ctccgccggttcgcacagcagttcgacggagtgaacgtaggtgatctgcgcgtgagttcc
gctgagattgaagccgcgtatcaacaggtggatgaagatttcctcacagccattcgggaa
gcgtcggtgaatatacgccggttccacgagaagcagatgcgcacctcctggatggatctg
cagggcgacggcagcatcctcggccaggtgatccggccgctgcgccgcgttggtttgtat
gttccgggcggtaaggcggcatacccgtcctcggtgctcatgaacgccattcccgcccag
gtggccggtgtgccggagatcgtcatggtcaccccgccggctacggcaggggtggaaggc
atcgatccgcatatcctcgtggcggctgcggaagccggcgtgaaggagatctaccgcgtc
ggcggcgcccaggcggtggcggcgctggcttatggcacggagtcgatccctgcggctgac
aaaatcgtcggaccggggaatatctacgtagccctggctaagcggtatgtgttcggcgcc
gtggacatcgattccatcgcgggaccgagtgagatcgtggtgctggcggacggcagtgcc
gatccggcttatgtggccgccgatctgctgtcccaggcggagcacgacgaaatggcttca
gcgattctgattacgccgtcggaggatctcgcgaacgccgtgcggaccgaggtggagctg
cagctgcaggcgctgccgcggcgcgagatcgctgcacagtcgatccgcgattacggcgca
atccttacggtctcctcgctcgaagagggcgtcgatgcggtgaaccggctggcgccggag
catctcgagattctggtggccgacccgttccaatacctcagccgcattgagaatgcggga
gcggttttcctcggcccgtacagctcggagccggtaggcgactattttgcgggaccgaac
catgtgctgccgaccaacggtacggcacggttctcttcgccgctgaacgtcgatgatttt
ctgaagaaatccagtgtgatctattacagtaaggaagctctgctgcgtgacggggagaag
atcatgacgctggcccgccacgaagggctcgaagctcacgcgcgtgcaattgaaatccgg
ttggagaaggaagggaaccgcaatggccaatga

DBGET integrated database retrieval system