KEGG   Paenibacillus mucilaginosus 3016: PM3016_1780Help
Entry
PM3016_1780       CDS       T01757                                 

Definition
(GenBank) S-layer domain-containing protein
Organism
pmq  Paenibacillus mucilaginosus 3016
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2012956..2016753
Genome map
AA seq 1265 aa AA seqDB search
MNSTASSRVKRFTYMIKLLLCTAIVLAGAVPLSLSASAQPLPDLVFFGENPNTSHWGVEV
QKENDLLPFDASVAFNGHPAHRVTNVSGGWWGIGMTLQWTTRDISGYIPYGALEFELKGS
RGGELLQFSLSDGRSPAAETGSVPAEASASWNHVTIPLAQFPQIGSFPASAWNTLLITKV
NGEDLNTLWLSDMKFTSRYITGYEPLILTAPQGTVPAMPSVVTAVYSDSTTTEVPVTWSG
VPDGSAAGAFTVQGHVAGVSVQPTAEVTVGTEADQGTGSEEPQPAQETPPAVETPSPETV
PSSGQQEHVVFEGVRTDQYFGSGGNLKLETDLVSTSSLPVDSTVEGTYNGQPSYKIAVTK
LADPNWGYWNGVLAADGWTSYSLEAFREGTLEFYVKGAAGGEDFVIGIMDTNDVKSVLSL
SGLAQTVTTDWSLIRIPLSRFTEQAPDLDLSIIDKVVLENASTQGEMSVWLNRIKFTQNP
AAELEIASVDPVKAVTVAGLPPELPQEVPVTYENGTTGTANVSWEAGDGYRVRGRYTVRG
TILQDTGPVPVTAEVTVVRALSDEPHVIFLDKKKAQWASAEGHFSLGMEQALDDQGMPVT
NEQGNPVMTLPVDPQVTFGGLPAYRLQVTRIPGPNWGYWGTGLTMDNWNPVNLEALYERG
SLDFMIKGLAGGESFSVVLTDRAGALGTVKLSDVAAVTTGWRQVSIPLKRLVPVSSAHRL
KESTAVTFTSDTGTGAAPLTVWLSDVRLASEASREVVRFGTKLPVQAQQLPQLPELPATA
EAVYNDGTTEQVPVAWDAVTFSSWGYPNPVQGTAQGIDLPATLQFTVEGSRSSGSSGSGS
GSGSAGMPEEPEAPIAAPVVPAASSLYPNGAAGTYTLPALKPAVDPADALLAVVNVQPGA
LKEGYKAAAPGPGQRPVMHIKVPYMSGVTGYAVKLPAGAVSGAYPDAELSVTTDLGRVVL
PADLLNPDQLNGAAAIRLVIRRSDTADMKKTAREQVGGRTVLDIHLEADGVILPWESREK
RVLVSPDYAPTDEELEHPERLVILYLGEDGEAEPVPSGRYDRTGGRMIFSAGHFSRYAVA
WGSRTFGDLAGYGWAQEAVELLASRGIVQGTGPAEFAPGRGVTRAEFVSLLVRTLDLAGL
PAEADFRDVDPSSPHYQAIAAAARLGIAGGIGGGLFAPDAPVSRQDVIVLTERALERAGR
LHAGAADSLPSGVFRDAEDLAGYAVPAVSALYGAGLIEGAGGLLRPEAEMSRAEAAVLLN
RIYPY
NT seq 3798 nt NT seq  +upstreamnt  +downstreamnt
atgaattccacggcttcctcacgggttaagcggtttacatatatgatcaagctcctgttg
tgcactgctatcgtgttggcgggggctgttccgctgtctctttcggcttcggcgcagcct
ttacctgatctggtgttcttcggagagaaccccaatacgagccactggggcgtagaagta
cagaaggagaacgatctgctgccgttcgacgcatcggttgctttcaacggacatcccgca
caccgggtgacgaatgtgtccggaggctggtggggcatcgggatgacgctgcagtggaca
acgcgcgatatcagcggctatatcccgtacggagcgctggagtttgagctgaagggcagc
aggggcggggagctgctccaattctcgttgtcggacggacgctcaccggctgccgagacg
ggctccgtaccggcggaggcttccgcctcttggaaccatgtgacgattccgctcgcccag
ttcccgcagatcggcagcttcccggcctcggcatggaatacgctgctgatcactaaagtc
aacggggaggatctgaacacgctgtggctcagcgatatgaaattcacctcccggtacatt
accggatatgaaccgcttattctgaccgctccgcaggggacggtaccggccatgccatcc
gttgtgacagccgtgtacagcgacagcacgacgaccgaggtgcccgtgacctggagcggc
gttccggacggctcggcggcgggcgccttcacggtgcagggccatgtggccggagtatcc
gtgcagcccacagccgaggtaacggttggcacggaggcggaccaagggaccggctcggag
gagccgcagccggcacaagagactccgccggcagtggaaaccccctcgcccgagacagta
ccttcgtccggccagcaggagcatgtggtgtttgaaggggtgcgaaccgatcaatatttc
ggctcgggcggcaacctgaagcttgaaacggacctggtcagcacgagctccctgccggtc
gacagtacggtggagggcacctataacgggcagccttcctacaagatcgctgtcacgaag
cttgccgacccgaactggggctactggaacggagtgcttgcggccgatggctggacgagt
tattccttggaggctttccgggaaggcaccctcgagttttatgtcaaaggagcggccgga
ggcgaggacttcgtcatcggcatcatggacaccaatgacgtgaaatcggtcttgtccctt
agcgggctggcccagaccgtcaccacggactggtctctgatccgcatccccctcagccgg
ttcacggagcaggctccggatctggatctcagtatcattgacaaagtggtactggagaac
gcatcgacccagggagagatgagcgtatggctgaaccggatcaagttcacgcagaaccct
gcggcagagcttgagatcgccagtgtcgatccggttaaggccgtaaccgtggcgggcctc
ccacccgaactgcctcaagaagtgccggtcacttacgaaaatggaacgacaggcacggcc
aacgtcagctgggaggctggcgacgggtatcgggtccgcggccgctataccgtccggggg
acgatcctgcaggacacaggccccgtaccggtaaccgcggaggtgaccgtagtccgtgca
ctttcggatgagcctcatgtcatttttcttgataagaaaaaagcccaatgggcgagtgcc
gaggggcatttctccctgggtatggaacaggcgctagatgaccaaggcatgccggtcacc
aatgaacagggcaacccggtcatgaccctgccggtcgacccgcaggtcaccttcggcggg
ctgccggcataccggctgcaggtcacccgtattcccggccccaactgggggtactggggt
acgggactcaccatggacaactggaatccggtgaatctggaagctctgtacgaacgcggc
agcctggattttatgatcaagggccttgccggcggagaatcgttctccgtcgttctcacg
gaccgggccggagcacttgggactgtgaagctctccgatgtggctgcagtgacgacgggc
tggcgccaggtgtcgattccgctgaagcggcttgtacccgtctctagcgcccacaggctg
aaagaaagcacggccgtcacgtttacgtcggatacgggcaccggtgcggccccgctgacc
gtatggctgagcgatgtgcgattggcgtccgaagcgagccgggaggtggtccgtttcggg
acgaagctccccgtgcaggctcagcagcttccgcagctgccggagctgccggccacggcc
gaggctgtatacaatgacggcacgacggagcaggttcccgttgcgtgggacgccgtgacc
ttctcctcctggggctacccgaatccggtgcagggcacggcgcaggggatcgatctgccg
gcgacgctgcagttcaccgtcgaaggcagccgcagcagcggttcctccggctcgggttcg
ggctccggctccgcaggaatgccggaggagcccgaggccccgatcgccgcaccggtcgtc
ccggcggcatcgtcgctgtatccgaacggagcggccggcacctacacgctgcctgccctc
aagccggcggtggaccccgcggacgccctgctggctgtcgtcaacgttcaacccggcgct
ctcaaagagggctacaaagccgcagcaccggggcccggtcagcgccccgtcatgcacatc
aaggttccgtacatgagcggcgtgaccggctatgcggtcaagctgccggcaggggccgtg
tcgggagcctacccggatgcggaactctccgtcaccacggaccttggcagagtcgtgctg
ccggcagatctgcttaacccggatcagctgaacggcgctgcagcaatacgtctcgtgatt
cgcaggtcggacaccgcggatatgaagaaaacggcccgcgagcaggtaggcggccgcacc
gtgctcgacattcacctggaggcggacggcgtcattctcccttgggagagcagggagaaa
cgggtcctcgtgtctccggactacgcgccgaccgatgaagagctcgagcatcccgagcgc
ctggttattctctacctgggcgaggacggggaggccgagcccgtgccgagcggccgctat
gaccgcaccggcgggcgcatgatcttctccgccggccatttcagccggtatgcggtggcc
tggggcagccgcaccttcggagacctggccggctacggctgggcgcaggaggccgtggag
ctgctcgcttcgcgcggcatcgtccagggcaccggtcctgcggagttcgctcccggcagg
ggagtgacccgggccgagttcgtctcgctgctggtccgcacgctggacctcgccggactg
cccgctgaagcggacttccgcgacgtggacccgtcgagtccgcattaccaggcgattgcg
gcagctgcaaggctcggtatcgccgggggcatcggcggcggcctgttcgcgccggatgca
ccggtctcccgccaggacgtcatcgtcctgacggagcgggcgctggagcgggccggccgg
cttcatgccggggcggcggacagcctgccctccggcgtcttccgcgacgcggaagacctc
gcgggctatgccgtaccggcggtgtcggccctgtacggggccggtctgatcgagggggcc
ggcggcctgctgcgtcccgaagcggagatgagccgggcggaagccgccgtgctgctcaac
cggatttacccatactga

DBGET integrated database retrieval system