KEGG   Paenibacillus mucilaginosus 3016: PM3016_1782Help
Entry
PM3016_1782       CDS       T01757                                 

Definition
(GenBank) putative signaling protein
Organism
pmq  Paenibacillus mucilaginosus 3016
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2018997..2021582
Genome map
AA seq 861 aa AA seqDB search
MAVPEAAGRKGSVLIYTSFTFLAFLCYFLPVKLVLGTEMVFASFFFLITLRRFGAALTAL
QVTAVHVSASAFLHEPLLSSLVNTVEIGAVFLLLRTRLRSVLPAAALFWGLFGIPLLLVM
YYIRFGTLGAEIGLYTVTLLVSRLFNALMADLIWTYLPHLRKQAKAGGRTGVQLSRLLLH
LTLFSVIGSSFLFMVNTGKNAQSNLEAELQEEAAGLTASLSKSYASWSPEQVRALKLHSL
IQAGYFRELAVTASQWISDEGLLIGPRGEVIVTYGRGSLGAESDWMRRTEWRPLTPALYE
WRTPARLLDIPGNQWQRMAVVAEVPLPPFKLYMKMSTVQHKEEVLGYYLSQSVAVIFTTL
VIGVFALFIHRFVLGPTIRLAELTRDVPGRLKENRRIAWMPPSRISEIQTLLGNFQELTE
QLSVMLRETKAQAYYDALTGLPNRRHFNEHLQELLGPETEAAGTTAVLFIDLDRFKQIND
TLGHAVGDGLLQEVAARLTGIVGGRAFIARLGGDEFVIVVQDTDSAEVCEMSKKVLRGLV
EAFQVGEHELFVAGSIGAALSPQDGSDPETVVKNADAAMYLAKEEGGNAYRFFSGQIAGS
ISENMRIEFDLRRAIERGELHLHYQPIVDAVDERVVGAEALLRWDHPELGPIPPLQFIGI
AESSGLIGTLGEWVLREACGQGARWLAQGLPLFGIGVNLSPTQLTHNNVVDYIGKVLEET
GLPPEYLNLEITEEVFSKKTERVIHDLTLLREMGVRVWVDDFGTGYSSLAMLSKLPVVGF
KIDRAFIREMGQDLAIVKTILSLAKDKEWIVVAEGIEDEAQKGALLELECRLQQGFHYSR
PMPPEELARLLEGQRKKGGTA
NT seq 2586 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgcctgaggctgccggcagaaagggttccgttcttatttatacttcgtttacg
tttcttgctttcttatgctactttctgccggtcaagcttgtgctggggacggagatggtg
ttcgcctcttttttcttcctgatcaccctgcggaggttcggagcggcacttacggccctt
caggtgacggctgtgcacgtgtcggcatcggcgtttcttcacgaaccgctgctgtcttct
ctcgtgaacacggttgagatcggggcggtctttctccttctgcgcacccgcttgcgaagt
gtgctgccggccgccgccctgttctggggactgtttggcatcccgctgctgcttgttatg
tattacatccgtttcgggacgcttggggcggagatcggactgtatacggtcacgctgctc
gtcagccgcctgttcaatgcgctgatggcggacctgatctggacctatctgcctcatctg
cggaagcaggcgaaggcaggagggcggaccggagtacagctctcccggctcctgcttcat
ctcactttgttcagcgtcatcggctcttcgttcctcttcatggtgaatacgggcaaaaac
gcgcagtccaatctggaggccgagcttcaggaggaggcggcgggactgacagcatccctt
agcaaatcctatgcatcctggagtccggagcaggtgcgggcactcaagctgcattcgctg
attcaggccggttatttccgggagctcgccgtcaccgcctcccaatggatctcggatgaa
ggactcctgatcggtccccggggagaggtcatcgtcacctatgggcggggctctctcgga
gcggagtctgactggatgcgacgtaccgagtggcgtccgctgacgcccgccttgtacgag
tggaggacgcctgcccggctgctcgatatcccggggaaccagtggcagcgcatggctgtg
gtggcggaagtcccgctgcctcccttcaagctctatatgaaaatgtcgacggttcagcat
aaggaggaagttctgggctattacctgagccaatccgtcgcggttatcttcacgaccctc
gtcatcggggtcttcgcactcttcatccaccgcttcgtgctggggccgacgatccggttg
gccgagcttacacgcgacgtgcccggcaggcttaaggagaaccgccggatcgcctggatg
cccccgtcgcggatcagcgagatccagaccctgctcggcaactttcaggagctgacggag
cagctgagcgtgatgctgcgcgaaaccaaggcgcaggcctactatgacgcgctgaccggt
ctgccgaaccgccggcacttcaacgagcacctgcaggagctgctggggccggagacggaa
gcggccggaacgacggcggtcctgttcatcgaccttgaccggttcaagcagatcaacgat
acgctcggccatgccgtcggggacgggctgctgcaggaggtggccgcccggctgaccggg
atagtgggcggccgggccttcattgcccggctgggcggcgacgagttcgtcatcgtggtg
caggatacggacagcgcggaagtctgcgagatgtccaaaaaggtgctccgcggactcgtt
gaagccttccaggtgggagagcatgagctgttcgtcgcaggcagcatcggcgccgccctg
tctccgcaggacggcagtgatcccgagacggtggtcaagaatgccgatgccgccatgtat
cttgccaaggaggagggaggcaacgcctaccgcttcttctcgggacagatcgcaggctcg
atctccgagaacatgcgcatcgaattcgacctccggcgggcgatcgagcggggggagctg
cacctgcattatcagccgattgtggatgccgtcgacgaaagagtggtcggagcggaagcg
ctgctgcgctgggatcatccggagctcgggccgatcccgcccctgcagttcatcgggatt
gcggagagcagcgggctcatcggcacgcttggggaatgggtgcttcgtgaagcctgcggg
cagggcgcacgctggcttgcgcaggggctgcccctgttcggcatcggggttaacctgtcc
ccgacccagctcacgcacaataatgtcgttgattatatcgggaaggtgctggaggaaacc
ggactgccacctgaatatctgaatctggagatcaccgaagaggtgttctccaagaagacg
gagcgtgtcatccatgacctgaccctcctgcgggagatgggggtccgtgtctgggtggac
gacttcggcacggggtattcctccctggcgatgctgagcaagcttcccgtggtcgggttc
aagatcgatcgtgcgttcattcgggagatgggtcaggacttggccatcgtcaagacgatt
ctttctctggccaaggataaggaatggatcgtcgttgccgaaggcatcgaagatgaggcg
cagaaaggggcgcttctggagctggaatgccggcttcagcagggcttccattacagcagg
ccgatgccgccggaggaactcgccaggctgctcgaaggccagcggaagaaaggggggacg
gcgtga

DBGET integrated database retrieval system