KEGG   Paenibacillus mucilaginosus 3016: PM3016_1787Help
Entry
PM3016_1787       CDS       T01757                                 

Definition
(GenBank) hypothetical protein
  KO
K07282  
gamma-polyglutamate biosynthesis protein CapA
Organism
pmq  Paenibacillus mucilaginosus 3016
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2029406..2030443
Genome map
AA seq 345 aa AA seqDB search
MPAELTIAAVGDILISQRIIASASVPGRIRKNFAPLLRHVAPILRRADLTIGNLEIPLAG
PEERYTRKSAATGFFTFNAPDELAADLKEAGFDLLVTANNHCLDRGLEGLQRTLDVLDEA
GLSHTGTYRTPEEAERPWIGEIRGIRVGVLAYSKSTNKIPIPKGSEWCVSLLDESRMVQE
IRALRLLTDVLVVCPHWGREYTHEPVNIQKRLMRRLLSAGADLVLGSHPHVIQPALRTPK
QAALYSLGNFISPTLMKRPATRSGLIFVARIVKEDDGTVWIRSADYVPTWTRRMGRGAAM
RYEVIPSAPVGLAAGRRFGLSRREEREFAGVVRHTMKVLRTPVRR
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgccggcagagctgaccattgccgccgtcggagacattctcatctcccagcggatcatt
gcctccgcctccgtgccgggccgcatccggaagaatttcgccccgctgctgaggcatgtc
gccccgatcctgcgcagggcggatctgaccatcggcaacctagagattccgctggccgga
ccggaagaacgctatacgcggaagtcggcggctaccggtttttttacattcaatgcgccg
gacgaactggctgccgacctgaaggaggcgggcttcgatctgctcgtcaccgcgaacaac
cactgtctggaccgggggctggaggggctgcagcggacactggatgtactggacgaggca
ggtctgtcgcataccggcacctaccggacgccggaggaagcggagcggccctggatcggt
gagatccgcgggatccgggtcggcgtgctcgcttactcaaagagcaccaacaagataccg
atcccgaaggggagcgaatggtgcgtcagcctgctggacgaaagccggatggtgcaggag
atccgggcgctgcggctcctgacggatgtgcttgtcgtgtgtccgcattgggggcgggaa
tatacccatgagccggtcaacattcagaagaggttgatgcggcgcctgctgtccgccgga
gcggatctcgtcctcggctcgcatccgcatgtgatccagccggccctccggacgccgaag
caggcggccttgtactccctcggcaacttcatctccccaaccctgatgaagcggcccgcg
acccgcagcggcctgatcttcgtcgcccgtatcgtcaaggaggatgacgggactgtctgg
atccgcagcgccgactatgtgcctacctggacccgcaggatgggcaggggagccgccatg
cggtatgaggtgatcccttcggcgcccgttgggctcgcagccggccggcggttcggcctg
agccgccgggaggagcgggagttcgccggggtggtgcgccatacgatgaaggtgctccgg
acgccggtcaggcgataa

DBGET integrated database retrieval system