KEGG   Paenibacillus mucilaginosus 3016: PM3016_1790Help
Entry
PM3016_1790       CDS       T01757                                 

Definition
(GenBank) hypothetical protein
  KO
K18346  
vancomycin resistance protein VanW
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Vancomycin resistance
Two-component system
Brite
KEGG Orthology (KO) [BR:pmq00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PM3016_1790
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    PM3016_1790
Antimicrobial resistance genes [BR:pmq01504]
 Gene sets
  Vancomycin resistance modules
   Vancomycin resistance, D-Ala-D-Lac type [MD:M00651]
    PM3016_1790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2032237..2033061
Genome map
AA seq 274 aa AA seqDB search
MIKHRIGKTFPWLYEVRMRQLQWARRWADRRSGVRFARVQRQEPLASITARHRSVLRRRL
AGTDPQLQENKIVNLRLSLPLIDGLVLRPGETFSFWDRIGRTTPERGYAEGLMLSRGEVR
SGPGGGLCQLANLLFWLGLHSSLTVAERHHHSFDLFPDERRTVPFGSGTSVFYNYVDLRL
RNDTEREYQFRVWLTDEYLAGELRSSSEEAWVYRVEERKHRLFERGGRRYRSNEIWRLRL
DRSGQQVLGEEKLLDNLAEVRYRTREGTGMEQQG
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaacaccgcatcggcaaaacctttccatggctctatgaagtgcgcatgaggcag
ctgcagtgggcgcgccggtgggcggaccggcggagcggggtgcgtttcgcgcgggtgcag
cggcaggagcctttggccagcataaccgccagacacaggtcggtgctccgcaggaggctg
gcgggcaccgatccgcagctgcaggagaacaagatcgtgaaccttcggctcagtctgccg
ctgatcgacgggctcgtcctccgtcccggcgagacgttctcgttctgggaccggatcggg
cggacaacgcccgagcgcggatatgcggaagggctcatgctctcccggggcgaggtgcgc
agcgggccgggcggcgggctgtgccagctggccaacctgctgttctggctcgggctgcat
tcgtctcttaccgtggcggagcgtcatcatcacagcttcgacctgttcccggatgagagg
aggaccgtcccgttcggcagcgggaccagcgtgttctacaactatgtcgaccttcgtctg
cgcaacgatacggagagggagtatcaattccgggtgtggctgacggatgaatatctggcc
ggcgagctgcggagctcctccgaggaggcttgggtctaccgggtcgaggagaggaagcac
cggttgttcgagcgcggaggtcgccggtaccgcagcaacgaaatctggcggctgcggctc
gaccgcagcggtcagcaggtgctgggggaagaaaagctgctggataatctcgcggaagtc
cgctaccggacaagggaggggaccggcatggagcagcagggttga

DBGET integrated database retrieval system