KEGG   Paenibacillus mucilaginosus 3016: PM3016_1793Help
Entry
PM3016_1793       CDS       T01757                                 

Definition
(GenBank) methyl-accepting chemotaxis protein
  KO
K03406  
methyl-accepting chemotaxis protein
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:pmq00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PM3016_1793
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    PM3016_1793
Bacterial motility proteins [BR:pmq02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    PM3016_1793
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2035727..2037766
Genome map
AA seq 679 aa AA seqDB search
MSLQKRLPLIIIGLVILSLVISSALTYIYGGNLIVAESKGKLSANSNRIGETVYSLVQGE
ITHAELLAKNSLFLELLQLRDRTPSDAEFFTPQNELMVKAHKVLRSSIASLKDHEKLFVV
DRNGVLVAGSAEKDETGALKIPDRPYFVEAMKGKLSVSDVLISKSKQEQIVVFAVPVKDD
AGNVIGVIGNSVYAAYFSKHLAGLDLGNNALVYIMERGGSYMAHSHDPALVKTKPEQQLL
LDIAAAPASEQLTYGEEEIASGSGTAFLGHTKIPVTNWTVMVQNDYTDIRKPLGSLYTKL
AVVSLAVLVLTSVVGFVLSRRVTRPVVELTSVFRELAAGNLAVQAKGDYQGEMKVLADSI
NAMVDNNRELLSNMNRSIEVLNDSTKELEHTSRQTARVFGDTSATSSEIARAMESQSHET
EHIVGRFTDVGDKINAVSRMAESVKERANGIIDVFRQNKNVIEQLIATNDKNEVEVGNIS
SLTGKLEESSKSIGAITGAIADIANQTNLLALNASIEAARAGEHGRGFAVVADEIRKLAE
QSSRQSAEIDSIIQRTLGYVQENNASVRQINDIAVQQDAFVRQTQEAFATIFNHVQDIAK
HIEEMAGAVGGIQQAKVEVLDSAQSLSASGEEVSASVQEVTATMQEQAVMVQQLTGMVEA
IDSLSKELAQAASRFKLNG
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgcaaaagcgtctgccccttattattatcgggcttgtgattctgtccctcgtc
atctccagtgcgctgacgtatatctacggcggtaatcttatcgtagcggaaagcaagggc
aagctctcggcgaactcgaaccggatcggggaaacggtatactccctggtgcagggcgag
attacccacgccgagctcttagccaagaacagcctgttcctggagctgcttcagctcaga
gaccgcacgccgagcgatgctgaattctttacacctcagaatgagctgatggtgaaagcg
cataaggtactccgcagctccatcgccagtctcaaggatcatgaaaaattgttcgtcgtt
gaccgtaacggagtactggtggcgggcagcgcggagaaggatgagaccggtgccctcaag
attccggaccgtccttactttgtggaagcgatgaaagggaagctttccgtctccgacgtg
ctcatctcgaagtccaagcaggagcagatcgtcgtcttcgccgtgccggtcaaggacgac
gcgggcaatgtcatcggcgtcatcggcaactcggtctacgccgcttacttctcgaagcat
ctggccggcctggatctcggcaacaatgcgctcgtctacattatggaacgcggcggctcc
tacatggcccactcccacgacccggcgctcgtgaaaacgaagccggagcagcagctgctg
ctggacatcgcagcggccccggcctcggagcagctcacctacggtgaagaggagatcgct
tcgggcagcggcacggccttcctaggacatacgaagataccggtgacgaactggaccgtt
atggtacagaacgattacaccgatatccgcaagccgctcggctcgctctatacgaagctg
gccgtcgtctccctcgccgtgctcgtgcttacctccgtggtcggcttcgtgctttcgcgc
cgggtaacccgtccggtcgtcgagctcacgtccgtcttccgcgagctggcggccggcaac
ctggccgtacaggcgaagggcgattaccagggagagatgaaggtgcttgccgacagcatc
aatgccatggtggataacaaccgtgagctgctgagtaacatgaaccgttcgattgaagtc
ctcaacgacagcaccaaagagctggagcacacttcgcggcagaccgcccgggtgttcggc
gatacttcggcaacaagctcggagattgcaagagcgatggagtcccagtcccatgaaacc
gagcatatcgtcggccggttcacggatgtcggcgacaaaatcaatgccgtcagccggatg
gccgagtccgtcaaggaacgggcaaatgggatcatcgacgtgttccgccagaacaagaac
gtcattgagcagctcatcgccaccaatgacaagaacgaagtggaagtcggcaacatctcc
agcctgacgggcaagcttgaagaaagctcgaagagcattggcgccattaccggtgcgatc
gccgatattgcgaaccagacgaacctcctcgcgcttaacgcctccatcgaggcggcacgc
gccggtgagcacggccgcggcttcgccgtggtggccgacgagatccgcaagctcgccgag
cagagctccaggcagtccgccgagatcgattcgatcatccagcgtacgctcggctatgtg
caggagaacaatgcgagcgtaagacaaatcaacgacattgcggtacagcaggacgccttc
gtacgccagacgcaggaagcgttcgctacgatcttcaatcatgtgcaggacatcgcgaag
catatcgaagagatggccggtgccgtaggcggtatccagcaggcgaaggtggaagtgctg
gattcggcgcagagcctgtccgcttccggggaagaagtgtcggcctccgtgcaggaggtg
acggcgaccatgcaggagcaggcggttatggtacagcagctgaccggcatggtggaagcg
atcgattcgctgtccaaggaattggcgcaggcggcgtcccgtttcaagctcaacggataa

DBGET integrated database retrieval system