KEGG   Paenibacillus mucilaginosus 3016: PM3016_1801Help
Entry
PM3016_1801       CDS       T01757                                 

Definition
(GenBank) AraB
  KO
K00853  
L-ribulokinase [EC:2.7.1.16]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Pentose and glucuronate interconversions
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmq00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PM3016_1801
Enzymes [BR:pmq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.16  ribulokinase
     PM3016_1801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2044599..2046269
Genome map
AA seq 556 aa AA seqDB search
MAIQYAIGIDYGTESGRALLVNLSNGEEVATHVTPYPHGVIDEELPESGVKLEYDWALQH
PADYIEVLKRSVPAVMKESGIDPAEVIGIGIDFTACTMLPIDETGTPLCFKPELRELPHS
WPKLWKHHAAQDEANLINEIAYERGEAFLPRYGGKISSEWMLAKVWQVLNEAPDLYNRTD
RFVEAGDWIIAQMTGSLIRNSCAAGYKSMWHKRDGYPGKDFFGALDPRLTNLTETKLRGE
VLPLGTKAGELTAGMAELMGLRPGIAVAVGNVDAHAAVPAVGVTAPGKLVMAMGTSICHM
LLGTEEKLVEGMCGVVEDGIIPGFLGYEAGQTAVGDIFAWYVEQAVPAYVTEAARAEGVS
VHEWLEKRAAAYRPGQSGLLALDWWNGNRSVLVDTNLTGLILGCTLLTKPEEIYRALLEA
TAFGTRKIIDTFHSSGVEVNELYACGGLPQRNRLLMQIYADVTNREIKIAASTQTPALGA
AMFGAVAAGSAQGGYDSIVEAAGKMARVREETFQPIPENVAVYEKLYEEYSRLHDYFGRG
GSDVMKRLKAIKESPQ
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggccatccaatatgcgatcggtatcgactacggtacggaatccgggcgtgcgctgctc
gtcaacctctcgaacggggaggaagtcgcgacgcatgtcaccccttacccgcacggcgta
atcgatgaagagctgcccgaatccggcgtgaagctcgaatacgattgggcgctgcagcac
ccggccgactatatcgaagtactgaagcgctccgtgccggcggtcatgaaggagtcgggc
atcgacccggcggaggtcatcggcatcgggatcgactttacggcatgcaccatgctgccg
atcgatgagaccggaacgccgctctgcttcaagccggagctgagggagcttcctcacagc
tggccgaagctctggaagcaccatgccgcacaggatgaggcgaacctgatcaacgagatc
gcctatgagcgcggcgaagcgttcctcccccgctacggcgggaagatctcgtccgagtgg
atgctcgccaaggtgtggcaggtgctgaacgaggcgcccgatctctacaaccggacggac
cgcttcgtggaggcgggtgactggatcatcgcgcagatgacaggcagccttatccgcaac
tcctgcgccgccggctataagtcgatgtggcacaagcgggacggctatccgggcaaggac
ttcttcggtgccctggatccgcggctgacgaacctcaccgagacgaagctccgcggcgaa
gtgctgccgctcggcaccaaagccggtgagctgacagccgggatggcggagctgatgggc
cttcgtccgggcattgcggtagccgtgggcaacgtcgatgcgcacgcggccgttcctgcg
gtgggcgtgactgcgccgggcaagctggtcatggcgatgggcacctcgatctgccacatg
ctcctcggcacggaagagaagctcgttgaaggcatgtgcggtgtcgtcgaagacggcatc
attccgggcttcctcggttatgaagccggacaaacggcagtaggcgatatcttcgcctgg
tatgtagagcaggcggtgccggcctatgtcaccgaagcggccagagccgagggtgtctcc
gtgcacgaatggctcgagaagcgggcggccgcctacaggccgggccaatcgggactgctt
gcgctcgactggtggaacggcaaccgctccgtgctcgtcgacacgaacctgacgggcctc
attctgggctgtaccctgctgacgaagccggaagagatctaccgagcgctgctggaagct
acagcgttcggtacgcgcaagattatcgacacgttccacagcagcggtgtggaagtcaac
gagctgtatgcctgcgggggactgccgcagcgcaaccgcctgctgatgcagatctatgcc
gacgtgaccaaccgcgagatcaagattgcggcatccacgcagaccccggctctgggagcg
gcgatgttcggtgcggtagccgccggttccgcgcagggcggatatgactcgatcgtcgag
gcggccgggaagatggcccgcgtacgcgaagagacgttccagccgattccggagaacgtc
gcggtctacgagaagctgtatgaggaatacagcaggctccacgattacttcggccgcggc
gggagcgacgtcatgaagcggctcaaagcaatcaaagaaagcccccagtga

DBGET integrated database retrieval system