KEGG   Paenibacillus mucilaginosus 3016: PM3016_1805Help
Entry
PM3016_1805       CDS       T01757                                 

Definition
(GenBank) hypothetical protein
Organism
pmq  Paenibacillus mucilaginosus 3016
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFC28715
UniProt: H6NH37
Position
complement(2049190..2049627)
Genome map
AA seq 145 aa AA seqDB search
MSRTRVHLCLAALLLPLLLLAGCESVPPPESLPAGPLDEFYPGELVSVDRIDLRSGMSGE
WRTVTNPEVIRDWVSKAGDLPFSPDPSQAQRAGFNYIVILFEKGEEKFSFLPTQFGKHYY
IPDPQFSPLLDELFEKGTKPVPGRY
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgcacccgcgttcatttgtgcctcgcggcgctcctgctgcctcttctgctgctg
gccggatgcgaatccgtacctccacccgagtccctgcccgccggaccgttggatgagttt
tacccgggagagctcgtctcggtggaccggatcgatctccgcagcggcatgagcggcgaa
tggagaacggtcaccaatccggaggtgatccgcgactgggtcagtaaagccggcgacctc
cccttctcccccgatcctagtcaggcacagcgtgccggattcaattacatcgtgatcctg
tttgagaaaggggaggagaagttctccttcctcccaacgcaattcggaaagcattactat
attcccgatccccagttttctccactcctggatgagctctttgagaaagggacgaagccc
gttccgggccgatactga

DBGET integrated database retrieval system