KEGG   Paenibacillus mucilaginosus 3016: PM3016_1807Help
Entry
PM3016_1807       CDS       T01757                                 

Definition
(GenBank) hypothetical protein
Organism
pmq  Paenibacillus mucilaginosus 3016
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YjzC
Motif
Other DBs
NCBI-ProteinID: AFC28717
UniProt: H6NH39
Position
complement(2050334..2050498)
Genome map
AA seq 54 aa AA seqDB search
MSGSNREYPTGETVPETGPYMCTEGALENFKKDEKFPESPKSGEKTLWQEYNKE
NT seq 165 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggatccaaccgggagtatccgaccggcgagaccgtgccggaaaccggcccctac
atgtgtacggaaggcgcactggagaacttcaagaaagatgagaagttccccgagagcccg
aagtccggtgagaagacgctgtggcaggagtacaacaaggaataa

DBGET integrated database retrieval system