KEGG   Paenibacillus mucilaginosus 3016: PM3016_1809Help
Entry
PM3016_1809       CDS       T01757                                 

Definition
(GenBank) small acid-soluble spore protein alpha/beta type
Organism
pmq  Paenibacillus mucilaginosus 3016
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2051693..2051980
Genome map
AA seq 95 aa AA seqDB search
MARRRSRSPVVPGAGQGLDRLKAEVMRRQGYAVQDARPDLVKYEVARSLGIPLQGTGNNQ
QLTTEQAGKIGGPIGGSMVREMIRMAQEHLAKRQP
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atggcaaggagaagaagcaggagcccggtcgtaccgggggcgggtcagggactcgacagg
ctgaaggcggaagtgatgcgccggcagggttatgcggtacaggacgcccgtccggacctg
gtgaagtatgaggtggcccggagcctcgggattccgctgcagggtacggggaataaccag
cagctgacgaccgagcaggcagggaagatcggcggccccatcggcggcagcatggtgcgg
gagatgatccggatggcgcaggagcacctggcgaagcgccagccttag

DBGET integrated database retrieval system