KEGG   Paenibacillus mucilaginosus 3016: PM3016_1814Help
Entry
PM3016_1814       CDS       T01757                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
pmq00010  Glycolysis / Gluconeogenesis
pmq00052  Galactose metabolism
pmq00500  Starch and sucrose metabolism
pmq00520  Amino sugar and nucleotide sugar metabolism
pmq00521  Streptomycin biosynthesis
pmq01100  Metabolic pathways
pmq01110  Biosynthesis of secondary metabolites
pmq01120  Microbial metabolism in diverse environments
pmq01130  Biosynthesis of antibiotics
pmq01200  Carbon metabolism
Module
pmq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pmq_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pmq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PM3016_1814
   00052 Galactose metabolism
    PM3016_1814
   00500 Starch and sucrose metabolism
    PM3016_1814
   00520 Amino sugar and nucleotide sugar metabolism
    PM3016_1814
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PM3016_1814
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    PM3016_1814
Enzymes [BR:pmq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PM3016_1814
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Hydant_A_N BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: AFC28724
UniProt: H6NH46
Position
2053786..2054757
Genome map
AA seq 323 aa AA seqDB search
MSRYIGIDIGGTNMVCGLTDGEGQVLRTVKIATEAPSGSKEVIRRLAEAVTGLMTHAGGQ
VSAVGIGLPGFVDHVQGISELAVNLGWKNVPLADELRGHIGDIPVFLDNDVRMYVYGEAV
AGAGRGFSHVLGVTIGTGMNSALVADGKLYYGAGGRAGEIGHVPMEGLTYPCNCGMTGCL
ETAVSANGIARQGREAVARGERSLLGEWFPEDGGARLTAADVSRAYDLGDAAAAAILRRT
GTLLGRGLAAAVTQLAPQVLIIGGGGAQAGERLLGPMKEELKRCVLPFYWEQLTVKTAER
LEDAGVVGSALYAKGRLEAQAQQ
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaggtatataggtatcgatatcggcggaacgaatatggtatgcgggttgacggac
ggggaggggcaggtgctgcgcacggtcaagattgcgacggaggccccgagcgggagcaaa
gaagtgatccgccggctggccgaggcggtgaccgggctgatgacccatgcaggcggacag
gtgtcagccgtggggatcggtcttcccgggttcgtggaccatgtccaggggatctccgag
ctggcggtgaatctcggctggaagaacgtgcctctggcggacgagctgcgggggcatatc
ggtgacattccggtattcctcgataacgacgtgcggatgtacgtctacggcgaagccgtg
gcgggagcgggccggggcttctcgcacgtgctcggcgtaacgatcggcactggcatgaac
tcggcgctggtggcggacggcaagctgtactacggcgccggcggacgggccggagagatc
gggcacgtgccgatggaagggctgacctacccgtgcaactgcgggatgaccgggtgtctc
gagacggccgtctccgcgaacggcatcgcccgtcagggacgcgaagccgtggcccggggg
gaacggtcgctgctcggcgaatggttcccggaggacgggggagcgcgcctgacagcggcc
gacgtctcgcgggcctatgatctgggcgatgcggcggcggccgccatcctgcggcggacg
ggaacgctgctcggccgcggacttgcggcagccgtgacccagctggccccgcaggtgctg
atcatcggaggaggcggagcgcaggccggagagcggctgctcggccccatgaaggaggag
ctgaagcgctgcgtgctgccgttctactgggagcagcttacggtcaagacagccgaacgg
ctggaggatgccggggtcgtcggaagcgctctgtacgcgaagggcagactggaagcgcag
gcacagcagtag

DBGET integrated database retrieval system