KEGG   Paenibacillus mucilaginosus 3016: PM3016_1818Help
Entry
PM3016_1818       CDS       T01757                                 

Definition
(GenBank) hypothetical protein
Organism
pmq  Paenibacillus mucilaginosus 3016
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2056845..2057222
Genome map
AA seq 125 aa AA seqDB search
MAGIKHAECKRIVERSDQLCADVEVQLEGEKQAFIALFTDAGDEDYRLEMILKNDADPAI
DWYDNDLHAAYEDVTEELFGGTQGGSGWSSKEEFKEAVLAYPGVRSQIRTQLDAAEALKL
QEIQA
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggccggaatcaaacatgccgagtgcaaacggattgtggagcgcagcgatcagctctgc
gccgatgtggaggtacagctggaaggcgagaagcaggcattcattgcactcttcaccgat
gcgggagatgaggactaccgtctggagatgatcctcaaaaacgatgcggatccggccatc
gactggtacgataatgacctgcatgccgcttacgaggatgtgaccgaggagctgttcggc
ggaacgcagggcgggtcaggctggagctcgaaagaggagttcaaggaagcggttctggct
tatcccggtgtccggtcgcagatccgcacgcagctcgatgcagcagaagcactgaagctg
caggagatccaggcctga

DBGET integrated database retrieval system