KEGG   Paenibacillus mucilaginosus 3016: PM3016_1821Help
Entry
PM3016_1821       CDS       T01757                                 

Definition
(GenBank) glycine oxidase ThiO
  KO
K03153  
glycine oxidase [EC:1.4.3.19]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Thiamine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    PM3016_1821
Enzymes [BR:pmq01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.19  glycine oxidase
     PM3016_1821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2058413..2059564)
Genome map
AA seq 383 aa AA seqDB search
MNTKHLTPSAGRPKAIIIGGGVIGCAAAFQLSEAGFDCTVLDKGRLCSEATTAAAGMLGA
QVETHHPGPFYELCRISQGMYRRWTDALEHTGGVSTEYIAEGILRAALTEEDEQELRSRL
AWIQDARWCTPDELRELEPALSPKVRGGLHFPADHQVHPAALARALKAALVKQGCTIREE
TPVFRLLKDTRSGRITGVQTAEGPLYADTVVLAAGAWSPALTEPLGLPLPMFPVKGQCIS
VKPQAPLTQSTVFTKGCYIVPKADGSCLVGATQVEAGFDKRATAAVIADLHARASALLPA
LADAEFLSTWAGLRPGTRDGLPFMGTWETAPGLIFATGHYRNGILLAPAAGRIVRQLALG
EKPLLDLAPFDPARHLNQPAPAL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaatacgaagcaccttaccccttcggccggccggcccaaggcgatcatcatcggcggt
ggcgtaatcggctgcgccgccgcattccagctcagcgaagccggcttcgactgcactgtg
ctcgataaaggccggctgtgcagcgaggcaaccaccgctgcagccggcatgctcggcgcc
caggtggagacgcatcaccccggcccgttctacgagctgtgccggatctcccagggcatg
taccgccgctggaccgacgcgctggagcataccggcggcgtgtccaccgagtacattgcc
gaaggcatcctccgcgcagcgctgacggaagaggacgagcaggagctccgctcccgcctc
gcctggattcaggacgcgcgctggtgcaccccggatgagctccgggagctggagccggcg
ctgtctccgaaggtccggggcggtctgcattttccggccgatcaccaggtccatcccgcc
gccctggcacgtgcgctgaaagccgcgctcgtgaagcagggctgcacgatccgtgaggag
acgccggtcttccggctgctgaaggacacccgcagcgggcgcatcaccggcgtgcagacg
gcggaaggtccgctgtatgccgacaccgtcgtgctcgccgccggcgcctggagccccgcg
ctgaccgagcccctcgggctgcctctgccgatgttccccgtcaagggccagtgcatctcc
gtgaagccccaggctccgctgacgcagtccacggtcttcacgaagggctgctacatcgtg
ccgaaggcggacggctcgtgcctggtcggcgcgacgcaggtggaggccggcttcgacaag
cgggccacggccgccgtcatcgcggacctgcatgcgagagcctccgccctgctgcccgct
ctcgcggacgccgagttcctctcgacctgggcgggccttcgaccgggcacccgggacggc
ctcccgttcatgggcacctgggagacagcgcccggcctcatcttcgcgacggggcactac
cgcaacggcattctgctcgcgccggccgccggccgtatcgtgcggcagctggccctcggc
gagaagccgctgctggatctcgccccgttcgatccggcccgccacctgaaccaacccgct
ccggctctatga

DBGET integrated database retrieval system