KEGG   Paenibacillus mucilaginosus 3016: PM3016_1824Help
Entry
PM3016_1824       CDS       T01757                                 

Definition
(GenBank) phosphomethylpyrimidine kinase
  KO
K00941  
hydroxymethylpyrimidine/phosphomethylpyrimidine kinase [EC:2.7.1.49 2.7.4.7]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Thiamine metabolism
Metabolic pathways
Module
Thiamine biosynthesis, AIR => thiamine-P/thiamine-2P
Brite
KEGG Orthology (KO) [BR:pmq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    PM3016_1824
Enzymes [BR:pmq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.49  hydroxymethylpyrimidine kinase
     PM3016_1824
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.7  phosphooxymethylpyrimidine kinase
     PM3016_1824
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2060468..2061313
Genome map
AA seq 281 aa AA seqDB search
MTLYKALTIAGSDSGGGAGIQADLKTFQMLDVFGTSAVTAVTAQNTLGVHGIYDIPLEGI
ERQIHAVLTDVGADAAKTGMLSQPQVIELVADCIAKAGLTRLVVDPVMVAKGGASLLAES
ARDALREKLLPLAAVVTPNLPEAEVITGLKLSSLDDMKKAAVVIVKEMGAGAAIVKGGHY
EGAPTDVLYDGESFHLLSAERYETRHTHGTGCTFSAAVCAELAKGRTLLEAAHTAKKFIT
LAIRYELGIGGGHGPTNHWAYTRHGGDTDSGVQLQKELTTP
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgactttgtacaaagcgttaacgatagccggctcggacagcggcggaggggccggcatc
caggccgacctcaagacgtttcagatgctggacgtcttcggcacgtcggccgtcacggcg
gtcactgcccagaatacgctcggcgtgcacgggatctacgacatcccgctcgaaggcatc
gagcggcagatccatgccgtcctgacagatgtgggggcggacgccgccaagaccgggatg
ctctcccagccgcaggtgatcgagctcgtcgcggactgcatcgcgaaggcggggctgacc
cggctggtcgtggacccggtcatggtggcgaagggcggcgcttcgctgctggccgagagc
gcccgggatgcgcttcgggagaagctgctgccgctggccgccgtcgtgacgccgaacctg
ccggaggcggaggtcatcaccggcctgaagctgagctcgctggatgatatgaagaaagcg
gccgtggtgatcgtaaaggagatgggggcgggagccgccatcgtcaagggcgggcactat
gagggcgccccgacggatgtgctctatgacggggagtcgttccatctgctcagcgcggag
cggtatgagacccggcatacgcacgggaccgggtgcaccttctcggcggcggtctgtgcg
gagctggccaaaggcagaacgctgctggaggcggcccatactgcgaagaagttcatcacg
ctggccatccgttacgagctgggcatcggcggcggccacgggccgacgaaccactgggcc
tatacgcggcacggaggggacacggacagcggggtacaattacagaaggagcttacgaca
ccatga

DBGET integrated database retrieval system