KEGG   Paenibacillus mucilaginosus 3016: PM3016_1827Help
Entry
PM3016_1827       CDS       T01757                                 

Definition
(GenBank) transcriptional regulator
Organism
pmq  Paenibacillus mucilaginosus 3016
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2062259..2062690
Genome map
AA seq 143 aa AA seqDB search
MKTEDGSTRKVIVTMLKTKGPLSAGEMAKQLGITEMAVRRHLHTLERDQLIEAKLVRQAM
GRPAHLYSLTEHADDLFPKKYQHLAMDLLEELELTAGADKVDFLFDRRKERLSLTLPGTD
GCQGLGGPRQGTGGDPERQRLYG
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgaagacggaagacggctccacacgcaaggtcatagtaacgatgcttaagaccaaggga
ccgctgagtgcaggggagatggcgaagcagctcggcattaccgagatggccgtacgccgg
catctgcacacccttgagcgggaccagcttatcgaggccaagcttgtgcggcaggccatg
gggcgtccggcccacctgtattccttgacggagcatgcggacgatctgttcccgaagaag
taccagcacctggcgatggatctgctcgaggaactggagctgacggccggtgcggacaag
gtcgattttctgttcgaccgccgcaaggaacggcttagtctcacgctaccgggaacggat
ggatgccaaggactgggcgggccgcgtcaaggaactggcggcgatccagaacgccaacgg
ctatatggttga

DBGET integrated database retrieval system