KEGG   Paenibacillus mucilaginosus 3016: PM3016_1835Help
Entry
PM3016_1835       CDS       T01757                                 

Definition
(GenBank) histidine kinase
Organism
pmq  Paenibacillus mucilaginosus 3016
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_5 HATPase_c_3 dCache_1 HATPase_c_2
Motif
Other DBs
NCBI-ProteinID: AFC28743
UniProt: H6NH65
Position
2069562..2071001
Genome map
AA seq 479 aa AA seqDB search
MMLRRRSLRLQMVSRFVIAVLLALVLVEGVFFIAVRQFYYSGIVGVLSNHAMVSTSFYTR
FAGDLHYTNLNQHLSRLVTSFAYETAELEIVDRDGSVLAGTSGFVSSGLVRTADVAEAWK
GGTGVWSGTNPATGEHIMAVSMPLIFGGQTLAVARYVTSLEEVDRVLRAIYTIAACVGLL
VLVLVILFSLTLADSIVRPIKVMTRASAEMARGRFDVRLDASHPNEIGELAGTLNYMASE
IVRSEALKNDWISSISHEIRTPLSSIKGWSETMLTGDLEDREETRLGLSIISKETERLVG
LVEELLDFSRLYQKNIELDLSAVPLQALVEEAALQMKSKTAAKRQELRLLLPEERLVVRG
DANRLKQVLLNLLDNAIKFTPAEGWVELEVARFDEATARVQVRDSGIGIAPEHLGKVEQK
FYQADPQKEGTGLGLAICQEIVALHGGTMQVASVEGEGTEVRVLLPLVMELGAEVAPGG
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgatgctccgccgccgctctctgcggctgcagatggtctcccgcttcgtgattgccgtc
ctgctggccctggtgctcgtagagggcgtctttttcatcgcggtccggcagttctattac
agcggcatcgtcggggtgctctcgaaccatgccatggtctcgacgtccttctacacccgg
ttcgcgggcgacctgcattatacgaatctcaaccagcatctgagccggcttgtgacgagc
tttgcttacgagacggcggagctggagattgtcgaccgggacgggagcgtgctcgccggg
acgagcgggttcgtgtcctccggcctggtgcgcacggccgacgtcgccgaagcctggaag
ggaggcaccggggtatggagcgggacgaacccggccaccggagagcacatcatggccgtc
tcgatgcctctcatcttcggtggccagaccctcgcagtggcccgctatgttacctcgctc
gaggaggtggaccgggtgctccgggccatctatacgatcgccgcgtgcgtcggcctgctg
gtgctggtgctcgtgatcctgttctccctcacgctggcggactcgatcgtgaggccgatt
aaggtgatgacgagggcgtcggccgagatggcccgggggcgcttcgatgtgcgtctcgac
gcctcacaccccaacgagatcggggagctggccggcaccctcaattacatggccagcgaa
attgtacgcagcgaggcgctcaagaatgactggatctcctcgatctcccacgagatccgt
acgcctctcagctcgatcaaggggtggagcgagacgatgctgaccggcgatctcgaggac
cgggaggagacacggctcggcctgtcgatcatctcgaaggagacggagcggctcgtcggc
ctggtggaggagctgctggatttctcgcggctctaccagaagaacatcgagctggacttg
tcggcggttccgctgcaggctttggtggaagaggcggcgctccagatgaaatccaaaacg
gcggccaagcgccaggagctgcgtctgctgctgccggaagagcggctcgtcgtgcgcggc
gatgccaaccggctcaagcaggtgctgctcaatctgctcgacaatgcgatcaagttcacg
ccggccgaagggtgggtggagctggaggtcgcgcgtttcgatgaggcgactgcccgggtt
caggtgcgggacagcggcatcggcatcgctccggagcatctcggcaaggtggagcagaag
ttctaccaggccgatccacagaaggagggcaccgggctcggccttgcgatctgccaggaa
atcgtggcgctgcacggcggaacgatgcaggtggcctcggtcgagggggagggcacggag
gtacgggtgctgctgccgctggtgatggagctgggagcggaagtggcgccggggggatga

DBGET integrated database retrieval system