KEGG   Paenibacillus mucilaginosus 3016: PM3016_1838Help
Entry
PM3016_1838       CDS       T01757                                 

Definition
(GenBank) hypothetical protein
Organism
pmq  Paenibacillus mucilaginosus 3016
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2073248..2073721
Genome map
AA seq 157 aa AA seqDB search
MWWQWGLGLCMLAFVVLAACAVRLMRDAGSSMRRTVQILEDVERQVKRSGEESERLLRAS
TAVVEELQQRMRAADPWLEAAAEAGTAAKRLSRSMQEAASSVERTVQEAQRALEGSRDTV
GDVVELTTAGLHLWQRWQASRQAKPKECREHDSTEKR
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgtggtggcagtgggggctcgggctttgtatgctggctttcgtcgtgctggccgcttgt
gcggttcgtctgatgcgcgatgccggctcgtcgatgcggcgtacggtgcagatcctcgaa
gacgttgagcggcaggtgaagcgcagcggggaagaatccgagcggctgcttcgcgcatcg
acggcggtggtcgaggagctgcagcagcggatgcgggcggcggatccctggctcgaagcc
gcagcggaagcggggacggcagccaagcggctgtcccgttcgatgcaggaagcggcgtcg
tcggtggagcgtacggtgcaggaagcgcagcgggccttggagggttcccgggacacggta
ggcgacgtggtagagctgacgaccgccggacttcatctgtggcagcgatggcaggcttcc
aggcaggccaaaccgaaggagtgtagagaacatgacagcaccgaaaaaaggtaa

DBGET integrated database retrieval system