KEGG   Paenibacillus mucilaginosus 3016: PM3016_1839Help
Entry
PM3016_1839       CDS       T01757                                 

Definition
(GenBank) hypothetical protein
Organism
pmq  Paenibacillus mucilaginosus 3016
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YtxH DUF1043 Synuclein LolA_2
Motif
Other DBs
NCBI-ProteinID: AFC28747
UniProt: H6NH69
Position
2073699..2074094
Genome map
AA seq 131 aa AA seqDB search
MTAPKKGKDLLVGAVVGTVLGAVTALLFAPKSGRELRSDIAEGAQQVGDKTQQLAADVAE
KSKQIVSVVSEKTQSAAGTISRGTSELAVKAKQAAAQVGQAFKKNGQGDGAEEVAAAQAS
VAATTAEAEEH
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgacagcaccgaaaaaaggtaaggatttgcttgttggcgccgtagtcggaacggtactc
ggagcggtgacggctctgctgttcgcgcccaagtcaggccgtgagctgcgctccgatatc
gcagaaggcgcacagcaggtaggggataagactcagcagctggcggcggacgtagccgag
aagtcgaagcagatcgtctccgtcgtatcggagaagacgcagtcggcggccgggacgatc
tcccgcggaacgtcggagctggccgtcaaagcgaagcaggcagccgctcaggtagggcag
gcgttcaagaagaacggccagggtgacggcgcagaggaagtggcggcggcccaagcttcc
gttgccgctacgacagccgaagcggaagagcattaa

DBGET integrated database retrieval system