KEGG   Paenibacillus mucilaginosus 3016: PM3016_1859Help
Entry
PM3016_1859       CDS       T01757                                 

Definition
(GenBank) MelA2
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
pmq00052  Galactose metabolism
pmq00561  Glycerolipid metabolism
pmq00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:pmq00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PM3016_1859
  Lipid metabolism
   00561 Glycerolipid metabolism
    PM3016_1859
   00600 Sphingolipid metabolism
    PM3016_1859
Enzymes [BR:pmq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     PM3016_1859
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4C Glyco_hydro_4 Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: AFC28765
UniProt: H6NH87
Position
2093525..2094826
Genome map
AA seq 433 aa AA seqDB search
MADKITFLGAGSTVFAKNVLGDVMLTSALQEFELALFDIDLERLKDSENMLNNLKATAGS
GCVVKAYTDRKEALRGAKFVVNAIQVGGYDPCTITDFEIPKKYGLRQTIADTLGIGGIFR
NLRTIPVMMEFARDMQEVCPDAWFLNYTNPMAVLTNAMITHGGIKTVGLCHSVQVCMPHL
FDALGMEKDGVQTKIAGINHMAWLLEVTKDGVDLYPEIKRRALEKQKEKHHDMVRFELMH
RFGYYVTESSEHNAEYHPYFIKKNYPELIDRFNIPLDEYPRRCVEQIERWKSMREELVGS
KNLEHQRSHEYASYIFEAMVTNQPFKIGGNVMNTGLITNLPKEACVEVPCLVDASGVTPT
YVGDLPPQLAALNRTNINTQLLTLEAAFTGKKEHIYHAALLDPHTAAELSIDDIVALCDD
LIEAHGGWLPKFQ
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggcagacaaaattacgtttcttggtgcgggaagcaccgtgttcgcaaagaatgtgctc
ggcgacgtcatgctgacgtcggcgctgcaggagttcgagctcgcgctgttcgatattgac
ttggagcggctgaaggattcggagaatatgctgaataacctgaaggcgaccgccggcagc
ggctgtgttgtgaaagcgtatacggaccggaaggaggcgctgcgcggggccaagtttgtc
gtcaacgcgatccaggtcgggggctacgatccctgcacgatcaccgacttcgagattccg
aagaagtacgggctccggcagacgattgccgacacgctcggtatcgggggcattttccgc
aacctgcgtacgattcccgtgatgatggagtttgccagggatatgcaagaggtgtgcccc
gacgcctggttcctcaattacacgaatccgatggctgtcctcacgaacgcgatgatcacg
cacgggggcatcaagacggtcggcctctgccacagcgtgcaggtgtgcatgcctcatctg
ttcgatgctctgggcatggagaaggacggcgtccagacgaagatcgcgggcatcaaccac
atggcgtggctgctcgaggtgaccaaggacggcgtcgacctctatccggagatcaagcgc
cgggcgctcgagaagcagaaggagaagcaccacgatatggtgcgcttcgagctcatgcat
cgcttcggctactacgtcaccgagtcctccgagcataatgcggaataccacccgtatttc
atcaaaaagaattatccggagctcatcgaccgcttcaacattccgctcgatgaatatccg
cgccgctgtgtggaacagatcgagcggtggaagtcgatgcgcgaggagctcgtgggcagc
aaaaatctcgaacaccagcgttctcatgaatacgcttcctatatcttcgaggcgatggtc
acgaaccagccgttcaagatcggcggcaacgtcatgaacaccggcctgatcaccaacctg
ccgaaagaggcctgcgtcgaggtgccgtgccttgtggatgcaagcggcgtaacgccgacc
tacgtcggggatctgccgccgcagctggccgcgctcaaccgcacgaacatcaacacgcag
ctcctgacgctggaggccgcgttcaccggtaagaaggaacacatctatcatgcggcgctg
ctcgatccgcacacggccgccgagctgtcgatcgacgatatcgtggcgctgtgcgacgat
ctgatcgaagcccacgggggctggctgccgaaattccagtaa

DBGET integrated database retrieval system