KEGG   Paenibacillus mucilaginosus 3016: PM3016_1860Help
Entry
PM3016_1860       CDS       T01757                                 

Definition
(GenBank) xylanase/chitin deacetylase
  KO
K01567  peptidoglycan-N-acetylmuramic acid deacetylase [EC:3.5.1.-]
Organism
pmq  Paenibacillus mucilaginosus 3016
Brite
Enzymes [BR:pmq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.-  
     PM3016_1860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polysacc_deac_1
Motif
Other DBs
NCBI-ProteinID: AFC28766
UniProt: H6NH88
Position
2095454..2096635
Genome map
AA seq 393 aa AA seqDB search
MNPTARMIMLTAALGALLTGCSVKVEDAVQPEAAKTPTAAGETAEGGRAKETKPAPKETA
GKETAAKEAAKPAGEAKPAADAKKSGSGEAQPKDAAAGADGAAASASKPAAGGSAKPDGA
DASAGAAKPADSAKNAAPAPRNPAAAAVGSAASKPAPAQGTGDRKALSWYYMKKPKGQVP
SFPGETKSYPQGTKALWVGTGKKVYLTIDTGGPLGDTKLLMKSLRDNKAKANFFIAGYNV
KKDPDFVRQLVKDGHLVANHTMTHSDMNEQTDEQIVKEIKDYEKLYKEVTGENIQPYFRF
PYGRYNMHILKTVSDMGYTSVFWSTAMRDWEPRKNGAEDPYNDIMNNLHDGNIILMHQGS
PENIQALDRIIKEVRKAGYEFALLTDIKPPATP
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaatcctaccgccagaatgatcatgctgaccgctgcgctcggggccctgctcacggga
tgcagcgtcaaagtagaggatgcggtacagccggaggccgccaagacaccaaccgctgcg
ggggagaccgctgaagggggccgggcgaaggagacgaagccggcgcccaaggaaacggcc
gggaaggaaacggctgcgaaggaagcggcgaagcccgccggggaggccaagcctgccgcc
gacgccaagaagagcggatcgggggaggcccagccgaaggacgccgctgcaggcgccgat
ggtgccgctgcgtccgcgtccaagccggcggccggcggcagcgcgaagcctgacggcgca
gacgcatccgccggcgcagccaagcccgcggacagcgcgaagaacgcagcgcctgccccg
cgcaacccggcggcagcggcggtcggaagcgcggcttcgaagccggcgcccgcccaggga
accggagaccgcaaggcgctctcatggtattacatgaagaagccgaagggccaggtgcca
agcttcccgggagagaccaaatcttatccccaaggcaccaaggcgctgtgggtcggcacc
ggcaagaaggtgtacctgacgatcgataccggcggcccgctcggcgacacgaagctgctg
atgaagtcgctgcgggataacaaggccaaggcgaatttttttatcgcaggctataatgtg
aagaaggatcccgactttgtgcgccagctcgtgaaggacggacacctggtggccaaccac
acgatgacgcacagcgatatgaacgagcagaccgacgagcagattgtcaaggagatcaag
gattacgagaagctgtacaaggaagtgacgggagagaacattcagccctacttccgcttc
ccctacggccgctataatatgcacatcctgaagaccgtctcggacatgggctatacctcg
gtcttctggtccactgcgatgcgggactgggagccgcgcaagaacggggcggaggatcct
tacaacgacattatgaataatctgcatgacggcaacatcatcctgatgcaccagggctcg
ccggagaatatccaggcgctcgaccgcattatcaaagaggtgcgcaaggccggctacgag
ttcgcattgctgaccgacattaagccgcctgccacgccataa

DBGET integrated database retrieval system