KEGG   Paenibacillus mucilaginosus 3016: PM3016_1863Help
Entry
PM3016_1863       CDS       T01757                                 

Definition
(GenBank) glycosidase PH1107-like protein
  KO
K18785  
beta-1,4-mannooligosaccharide/beta-1,4-mannosyl-N-acetylglucosamine phosphorylase [EC:2.4.1.319 2.4.1.320]
Organism
pmq  Paenibacillus mucilaginosus 3016
Brite
Enzymes [BR:pmq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.319  beta-1,4-mannooligosaccharide phosphorylase
     PM3016_1863
    2.4.1.320  1,4-beta-mannosyl-N-acetylglucosamine phosphorylase
     PM3016_1863
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2099001..2100011)
Genome map
AA seq 336 aa AA seqDB search
MTLPLIGPLSSAKIMRRHPANPVLKPSDVPYAPALVFNAGVTKYQGRYVMVFRCDYGDAE
SKTLLPSHTTNLGLAYSSDGIHWDVQPGPCFGLTDEEIIRTYDPRLTVIDGRCFMCFAVD
TKHGIRGGIAVTDDFERFEVLSMSVPDNRNMVLFPERIGSHYVRLERPMPVYSRGRDRFD
IWVSDSPDLKYWGNAKLLLGVEDLPYANDKIGPGAPPVKTSKGWLAAIHSVDIDPARGKN
GWEPAWKKRYCAGLALLDLEDPSRVIGLYRQPLLAPEAPYEAEEGFRTQVIFPGGMVLED
DGEVKIYYGAADTVECVAAAHVDDLVKLCLEGGPKG
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgactctgcccctgatcggcccgctgtcttccgcgaagatcatgcggcgccacccggcc
aatccggttctgaagccttccgacgtgccctacgcgccggccctcgtcttcaatgccggc
gtaaccaagtaccaaggccgctacgttatggtattccgctgcgattacggcgatgccgaa
tcgaagaccctgctgccgagccacacgacgaacctcggactcgcctacagctccgacggc
atccactgggacgtacagcccggcccgtgcttcggcctcacggacgaagagatcatccgc
acgtacgatccccggctgaccgttatcgacggccgctgcttcatgtgcttcgcggtggat
acgaagcacggcatccgcggcggcattgccgtcacggacgacttcgagcgttttgaggtg
ctcagcatgtccgtgccggacaacaggaacatggtgctcttcccggaacggatcggcagc
cattatgtccgcctcgagcgtcccatgcccgtgtacagccgggggcgcgaccggttcgac
atctgggtctcggactccccggatctgaagtattgggggaacgcgaagctgctgctgggc
gtcgaggacctgccgtacgccaatgacaagatcggccccggtgcgccgccggtcaagact
tcgaagggctggcttgccgccatccacagcgtggacatcgaccccgcgcggggcaagaac
ggctgggagcctgcgtggaagaagcgctactgcgcggggcttgccctgctcgacctggag
gacccgagccgcgttatcggcctctaccggcagccgctgctcgcgccggaagccccgtac
gaagcggaggagggcttccgcacccaggtgatcttccccggcggcatggtgcttgaggac
gacggcgaggtgaagatctattacggcgccgccgatacggtggaatgcgtggctgccgcc
cacgtcgacgacctggtgaagctgtgcctcgagggtggaccgaagggatag

DBGET integrated database retrieval system